SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G5ALN8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5ALN8
Domain Number 1 Region: 100-209
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 4.3e-27
Family Canonical RBD 0.0000629
Further Details:      
 
Domain Number 2 Region: 18-101
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 3.63e-26
Family Canonical RBD 0.0000148
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G5ALN8
Sequence length 277
Comment (tr|G5ALN8|G5ALN8_HETGA) Heterogeneous nuclear ribonucleoprotein D0 {ECO:0000313|EMBL:EHA97948.1} KW=Complete proteome; Reference proteome OX=10181 OS=Heterocephalus glaber (Naked mole rat). GN=GW7_10606 OC=Hystricomorpha; Bathyergidae; Heterocephalus.
Sequence
HSNSSPRHTEAATAQREEWKMFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDPITGRSR
GFGFVLFKESESVDKVMDQKEHKLNGKVIDPKRAKAMKTKEPVKKIFVGGLSPDTPEEKI
REYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEKKYHNVGLSKCEIKVAM
SKEQYQQQQQWGSRGGFSGRARGRGGGPSQNWNQGYSNYWNQGYGNYGYNSQGYGGYGGY
DYTGYNNYYGYGDYSNQQSGYGKVSRRGGHQNSYKPY
Download sequence
Identical sequences G5ALN8
HGL_H00000313199-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]