SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G5AM40 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  G5AM40
Domain Number - Region: 124-203
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.000124
Family Canonical RBD 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G5AM40
Sequence length 290
Comment (tr|G5AM40|G5AM40_HETGA) La-related protein 4 {ECO:0000313|EMBL:EHA98100.1} KW=Complete proteome; Reference proteome OX=10181 OS=Heterocephalus glaber (Naked mole rat). GN=GW7_16301 OC=Hystricomorpha; Bathyergidae; Heterocephalus.
Sequence
MLLFMEQVTSKGTGLNPNAKVWQEIPPGNPDATPVTQGTESSWPEIAATSGSQTEGSTEL
FEDMCKEYEIMYSPSCETTRNTTGIEEPAEGMILGPEDMSCQIYDISGEMLRSSPMVQAD
EKGEKVRPSHKCCIVLLREIPETTPVEEVKALFENENYPKVISCEFAHNSNWYITFQSDT
DAQQSFKYLREEVKTFQGKPIMLLRELRSNAVSPTKNQENGAPAKSVEKPHEKPEAKASK
DYSGFRGNTIPRGAAGKIREQRRQFSHRAIPQGVIRRNGKEQYVPPRSPK
Download sequence
Identical sequences G5AM40
HGL_H00000415464-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]