SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G5AMM3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5AMM3
Domain Number 1 Region: 493-549
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.31e-20
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 2 Region: 534-586
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.71e-18
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 3 Region: 437-493
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.18e-17
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 4 Region: 139-197
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.4e-17
Family KRAB domain (Kruppel-associated box) 0.0024
Further Details:      
 
Domain Number 5 Region: 388-437
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000189
Family Classic zinc finger, C2H2 0.023
Further Details:      
 
Domain Number 6 Region: 340-383
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000119
Family Classic zinc finger, C2H2 0.021
Further Details:      
 
Weak hits

Sequence:  G5AMM3
Domain Number - Region: 50-121
Classification Level Classification E-value
Superfamily Tropomyosin 0.000399
Family Tropomyosin 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G5AMM3
Sequence length 643
Comment (tr|G5AMM3|G5AMM3_HETGA) Zinc finger protein 398 {ECO:0000313|EMBL:EHA98283.1} KW=Complete proteome; Reference proteome OX=10181 OS=Heterocephalus glaber (Naked mole rat). GN=GW7_03480 OC=Hystricomorpha; Bathyergidae; Heterocephalus.
Sequence
MAEAAAAPTSEWDSECLTSLQPLPLPPPPAANDAHLQTAAISLWTVVAAVQAIERKVEVH
SRRLLHLEGRTGTAEKKLASCEKTVTELGNQLEGKWAVLGTLLQEYGLLQRRLENLENLL
RNRNFWVLRLPPGIKRDIPKVPVAFDDVSIYFSTPEWEKLEEWQKELYTNIMKGNYESLI
SMDYAMSQPDVLSQIQPEGEHNTEDQAGPEESDIPAVPSEEPGLSTSDILSWIKQEEEPQ
VGPPQEAKESEVYKGTYPEEELVIKAEGLVPATLCPQVPGAFSAAPAAAAKDAFSDVAFK
SQQSAPMTSFGCAATDLPEASEGQVTFTQLGSYPLPPTVGEQMFSCHHCGKSLSQDMLLT
HQCGHASEHPGPCAQCPKHFPVQPDLGSTSQDHAGEMPPTCPHCSRTFTHPSRLTYHLRV
HNSAERPFPCPDCPKRFADQSRLSSHRRAHTSERPFRCSQCGRSFSLKLSLLLHQRGHAQ
ERPFSCPQCGIDFNGHSALIRHQMIHTGERPYPCTDCSKSFMRKEHLLNHRRLHTGERPF
PCVHCGKSFFRKHHLMKHQRIHTGERPYPCALCGRSFRYKQTLKDHLRSGHSGGCAGDSD
PSAPPPEPPGPPLPVLETSGLGVSAEALETSQWYGDGTGGGML
Download sequence
Identical sequences G5AMM3
XP_004860517.1.39548 HGL_H00000338984

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]