SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G5AP11 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5AP11
Domain Number 1 Region: 72-269
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 5.61e-46
Family Voltage-gated potassium channels 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G5AP11
Sequence length 320
Comment (tr|G5AP11|G5AP11_HETGA) Potassium voltage-gated channel subfamily G member 2 {ECO:0000313|EMBL:EHA98771.1} KW=Complete proteome; Reference proteome OX=10181 OS=Heterocephalus glaber (Naked mole rat). GN=GW7_03723 OC=Hystricomorpha; Bathyergidae; Heterocephalus.
Sequence
MLLPAGSGPAYRAGLTVRPRQAVSRRARPAHGAMALLPGHAETPGPEPGGGSGGGGGAAR
ARHVIINGECSEKCRSLFVLETVCVAWFSFEFLLRSLQAESKCAFLRTPLNIIDILAILP
FYVSLLLGLAARPAGGRLLERAGLVLRLLRALRVLYVMRLARHSLGLRSLGLTVRRCARE
FGLLLLFLCVAMALFAPLVHLAERELGARRDFSSVPASYWWAVISMTTVGYGDMVPRSLP
GQVVALSSILSGILLMAFPVTSIFHTFSRSYSELKEQQQRAASPEPALGEDSTRSATATE
DSSQDPEGMSSAGGTISLSR
Download sequence
Identical sequences G5AP11
HGL_H00000315654

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]