SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G5AQ65 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5AQ65
Domain Number 1 Region: 334-423
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.76e-19
Family Canonical RBD 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G5AQ65
Sequence length 983
Comment (tr|G5AQ65|G5AQ65_HETGA) SAFB-like transcription modulator {ECO:0000313|EMBL:EHA99175.1} KW=Complete proteome; Reference proteome OX=10181 OS=Heterocephalus glaber (Naked mole rat). GN=GW7_13938 OC=Hystricomorpha; Bathyergidae; Heterocephalus.
Sequence
MDQRAEESEEACWEDLEGRSGFAGRALAPWVVRGVPLKGKKQEADELSGDASVEDDAFVK
DCELENQEAHEQDESDEIKDSEEFGENEEENANSKELLSAEENKRAHELIEAEAIEDVEK
EDIESQDIEAQEGEDDTFLTAQDGEEEENEKDIAGSGDGTQEVSKPLPSEGNLAEADHTA
HEEMEANATVKEAEDDNISVTIQAEDAITLDFDGDDLLETGKNVKITDSEASKPKDGQDV
VAQSPEKETKDYEMNVNHKDGKKEDFVKGDPVEKEARESSKKAESGDKEKDTLKKGPSST
GACGQAKSSSKESKDSKTSSKDDKGSTSSTSGSSGSSTKNIWVSGLSSNTKAADLKNLFG
KYGKVLSAKVVTNARSPGAKCYGIVTMSSSTEVSRCIAHLHRTELHGQLISVEKVKGDPS
KKEMKKENDEKSSSRSSGDKKNMNDRSSKTQTSVKKEEKRLSEKSEKKESKDNKKMESKE
EKNDNGTSGQISESSKKNEEKKRISSKSPGHMVILDQTKGDHCRPSRRGRYEKIHARSKE
KERASLDKKRDKDYRRKEILPFEKMKEQRLREHLVRFERLRRAMELRRRREIAERERRER
ERIRIIREREERERLQRERERLEIERQKLERERMERERLERERIRIEQEQRKEAERIARE
REELRRQQQQLRYEQEKRNSLKRPRDVDHRRDDPYWSENKKLSLDTDARFSHSSDYSRQQ
NRFNDFDHRERGRFPDSSAVQSSSFDRRERFVGQSEGKKARPTARRDDPSFERYPKNFSD
SRRSEPPPPRNELRDTDRRDVRGEREERRTVIMHDRPDMAHPRHPREAGPNPSRPASWKG
EGSMSADKRDARVERPERSGRDVSGHSVRGAPPGSRSNASGYGGRESDRGVISDRGSGAQ
HYPEERHVVDRHGRDTSGPDRAGPGYHDTRRMGDGRAGAGMMSQQHSSNASPINRIVQIG
GSSMPRGSGSGFKPFKGGPPRRF
Download sequence
Identical sequences G5AQ65
HGL_H00000369887-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]