SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G5AQI6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  G5AQI6
Domain Number - Region: 10-122
Classification Level Classification E-value
Superfamily Tropomyosin 0.015
Family Tropomyosin 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G5AQI6
Sequence length 163
Comment (tr|G5AQI6|G5AQI6_HETGA) Prefoldin subunit 6-like protein {ECO:0000313|EMBL:EHA99296.1} KW=Complete proteome; Reference proteome OX=10181 OS=Heterocephalus glaber (Naked mole rat). GN=GW7_04374 OC=Hystricomorpha; Bathyergidae; Heterocephalus.
Sequence
MSSNLQKEFPQSHNEDLDKDTPSQNCLERNAEHITDRLGMAQEEIQRLTHKLQMKEKELS
NLDSALEKAQLEIGKLKEKDEQTVLVSLLDTIDLQKAKEHNQRLDQEILALRSRVRSLDS
EKKFLGEMVEKLKAGMSESPKNKQLGNHSPEKSVGAEQRVKVF
Download sequence
Identical sequences G5AQI6
HGL_N10024277

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]