SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G5AS30 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5AS30
Domain Number 1 Region: 6-77
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000000000012
Family Canonical RBD 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G5AS30
Sequence length 241
Comment (tr|G5AS30|G5AS30_HETGA) MKI67 FHA domain-interacting nucleolar phosphoprotein {ECO:0000313|EMBL:EHA99840.1} KW=Complete proteome; Reference proteome OX=10181 OS=Heterocephalus glaber (Naked mole rat). GN=GW7_17326 OC=Hystricomorpha; Bathyergidae; Heterocephalus.
Sequence
MPGVTFVGRLPPVLFESQIKEYFSQFDYITRFRQSRSKRTGNSRGSAFVEFAFEAVAKMV
AERKGWQVPLHHPVYPAVKRYNHKRTLPQKLRMEDRFKKKEKLLRKKLIAKGIDDNFSSL
VLSTKKKEVSGKKGISTKKNKASDIPKKKKRVSEGSTVTPDKTVDSQSATPACAPTLLEK
RKSEVAEMKGDKDDEIVFKQPVSSVKDTPETPTPTRSGKKKTKAKKKQTVILNVLCAAYL
T
Download sequence
Identical sequences G5AS30
HGL_H00000285814-2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]