SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G5ASG6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5ASG6
Domain Number 1 Region: 3-109
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.49e-25
Family Canonical RBD 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G5ASG6
Sequence length 187
Comment (tr|G5ASG6|G5ASG6_HETGA) RNA-binding protein 4 {ECO:0000313|EMBL:EHA99976.1} KW=Complete proteome; Reference proteome OX=10181 OS=Heterocephalus glaber (Naked mole rat). GN=GW7_18520 OC=Hystricomorpha; Bathyergidae; Heterocephalus.
Sequence
MVKLFIGNLPREATGQEIRSLFEQYGKALEYDVIKNYGFVHMEDETAAEDAIHNLHRYEL
HGVNINVEASKNKGKASTKLHVGNVSPTCTNKELKGKCAEYGPFMECDMELLPPPLQVLL
QLPLHITGGIGAPCVALQAQSPLLEKARVPGMSVSCPKLLQPAGIPLNDMARYEQEQYAD
RAQYSAF
Download sequence
Identical sequences G5ASG6
HGL_M00000038256

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]