SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G5AT11 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  G5AT11
Domain Number - Region: 195-229
Classification Level Classification E-value
Superfamily Tropomyosin 0.0144
Family Tropomyosin 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G5AT11
Sequence length 331
Comment (tr|G5AT11|G5AT11_HETGA) BRCA1-A complex subunit Abraxas {ECO:0000313|EMBL:EHB00172.1} KW=Complete proteome; Reference proteome OX=10181 OS=Heterocephalus glaber (Naked mole rat). GN=GW7_21092 OC=Hystricomorpha; Bathyergidae; Heterocephalus.
Sequence
EGFLFGEVKGEAKNSITDSQMDDVEVVYTIDIQKYIPCYRLFSFYNSSGEVNKHALKKIL
SRVEKNVVGWYKFRRHTDQIMTFRERLLHRNLQKHLSNQELVFLLLTSSIVTESCSTHQL
EHALYQPQKGLFHRIPLVVTNLGMSEPLGYKTTSGSCTSTGFSRAVKIHSSEFFKEDGSL
KEVHKINEMYASLQEELKDVCNKVEGSEREVEKLIKDVNRLKQEIKKRQQVQIQAAREKN
VQKDPQENIFLCQALQTFFPDCEFLHSCVISLKTRQICESRCNVMHNLEVADKLTLMVEY
THSPEASPARTPQVTKRKAIGPDDGWQVKRA
Download sequence
Identical sequences G5AT11
HGL_H00000369857

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]