SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G5ATK0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5ATK0
Domain Number 1 Region: 419-749
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 2.34e-106
Family PDEase 0.00000132
Further Details:      
 
Domain Number 2 Region: 151-252
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.9e-17
Family Flavin-binding PAS domain 0.055
Further Details:      
 
Weak hits

Sequence:  G5ATK0
Domain Number - Region: 26-95
Classification Level Classification E-value
Superfamily CheY-like 0.00415
Family CheY-related 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G5ATK0
Sequence length 761
Comment (tr|G5ATK0|G5ATK0_HETGA) Phosphodiesterase {ECO:0000256|RuleBase:RU363067} KW=Complete proteome; Reference proteome OX=10181 OS=Heterocephalus glaber (Naked mole rat). GN=GW7_20429 OC=Hystricomorpha; Bathyergidae; Heterocephalus.
Sequence
MRLTQDPIQVLLIFAKEDSQSDGFWWACDRAGYRCNIARTPESALECFLDKHHEIIVIDH
RQSRNFNAEAVCRSIRATNPSEHTVILAVVSPASDDREEASVLPLLHAGFNRRFMENSSI
IACYNELIQIEHGEVRSQFKLRACNSVFTALDHCHEAIEITSDDHVIQYVNPAFERMMGY
HKGELLGKELAELPKSDKNRADLLDTINTCIKKGKEWQGVYYAQRKSGDSIQQHVKITPV
IGQGGKIRHFVSLKKLCCTTDKNKQMHKIHRDSGDISQTEFHSARHKNRRKESIDVKSIS
SRGSDAPSLQNRRYPSMARIHSMTIEAPITKVINIINAAQENSPVTVAEALDRVLEILRT
TELYSPQLGTKDEDPHTSDLVGGLMTDGLRRLSGNEYVFTKNVHQSHSHLVMPVTINDVP
PCITQLLDNEESWDFNVFELEAVTHKRPLVYLGLKVFSRFGVCEFLNCSETTLRAWLQVI
EANYHSSNAYHNSTHAADVLHATAFFLGKERVKGSLDQLDEVAALIAATVHDVDHPGRTN
SFLCNAGSELAVLYNDTAVLESHHTALAFQLTVKDAKCNIFKNIDRNHYRTLRQAIIDMV
LATEMTKHFEHVNKFVNSINKPMAAEIEGGDCECSPVGKNFPENQILIKRMMIKCADVAN
PCRPLDLCIEWAGRISEEYFAQTDEEKRQGLPVVMPVFDRNTCSIPKSQISFIDYFITDM
FDAWDAFAHLPALMQHLADNYKHWKTLDDLKCKSLRLPSDS
Download sequence
Identical sequences G5ATK0
HGL_H00000264917

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]