SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G5ATZ7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5ATZ7
Domain Number 1 Region: 6-92
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 3.22e-19
Family Canonical RBD 0.0000213
Further Details:      
 
Weak hits

Sequence:  G5ATZ7
Domain Number - Region: 135-184
Classification Level Classification E-value
Superfamily tRNA-binding arm 0.0167
Family Methicillin resistance protein FemA probable tRNA-binding arm 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G5ATZ7
Sequence length 214
Comment (tr|G5ATZ7|G5ATZ7_HETGA) Heterogeneous nuclear ribonucleoproteins C1/C2 {ECO:0000313|EMBL:EHB00508.1} KW=Complete proteome; Reference proteome OX=10181 OS=Heterocephalus glaber (Naked mole rat). GN=GW7_14429 OC=Hystricomorpha; Bathyergidae; Heterocephalus.
Sequence
MTSNVTNKTDPHSMNSHVFIGNLNTLVKKSDVEAIFSKYGKIVGSSVHKGFAFVQYVNER
NAWAAVAGEDGRMIAGQVLGINLAAEPKVNRGKAGVKRSAAEMYGSSFDLDCVFQRDYYD
RMGKCSFNSKSGQRGSSKSGKLKGDDLQAIKKELTQIKQKVDSLPESLEKIKKEQSKQAV
EVKNGKSEEEQTSTSLKKDETAVKMESEGAADDC
Download sequence
Identical sequences G5ATZ7
HGL_H00000338095-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]