SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G5AU18 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5AU18
Domain Number 1 Region: 224-385,445-507
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.96e-39
Family Voltage-gated potassium channels 0.0049
Further Details:      
 
Domain Number 2 Region: 510-694
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.36e-35
Family cAMP-binding domain 0.001
Further Details:      
 
Domain Number 3 Region: 41-135
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.44e-20
Family Flavin-binding PAS domain 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G5AU18
Sequence length 1082
Comment (tr|G5AU18|G5AU18_HETGA) Potassium voltage-gated channel subfamily H member 3 {ECO:0000313|EMBL:EHB00529.1} KW=Complete proteome; Reference proteome OX=10181 OS=Heterocephalus glaber (Naked mole rat). GN=GW7_14450 OC=Hystricomorpha; Bathyergidae; Heterocephalus.
Sequence
MPAMRGLLAPQNTFLDTIATRFDGTHSNFVLGNAQVAGLFPVVYCSDGFCDLTGFSRAEV
MQRGCACSFLYGPDTSELVRQQIRKALDEHKEFKAELILYRKSRLPFWCLLDVIPIKNEK
GEVALFLVSHKDISDTKTRGGPDNWKERGGGRRRYGRAGSKGFNANRRRSRAVLYHLSGH
LQKQPKGKHKLNKGVFGEKPNLPEYKVAAIRKSPFILLHCGALRATWDGFILLATLYVAV
TVPYSVCVSTAREPSAARGPPSVCDLAVEVLFILDIVLNFRTTFVSKSGQVVFAPKSICL
HYVTTWFLLDVIAALPFDLLHAFKVNVYFGAHLLKTVRLLRLLRLLPRLDRYSQYSAVVL
TLLMAVFALLAHWVACIWFYIGQREIESSESELPEIGWLQELARRLETPYYLVSRSPAEG
NSSGQSDNCSSSGEANKTGLELLGGPSLRSAYITSLYFALSSLTSVGFGNVSANTDTEKI
FSICTMLIGALMHAVVFGNVTAIIQRMYARRFLYHSRTRDLRDYIRIHRIPKPLKQRMLE
YFQATWAVNNGIDTTELLQSLPDELRADIAMHLHKEVLQLPLFEAASRGCLRALSLALRP
AFCTPGEYLIHQGDALQALYFVCSGSMEVLKGGTVLAILGKGDLIGCELPRREQVVKANA
DVKGLTYCVLQCLQLAGLHESLALYPEFAPRFSRGLRGELSYNLGAGGCPAEVDTSSLSG
DNTLMSTLEEKETDGEQGTTASPAPADEPSSPLLSPGCTSSSSAAKLLSPRRTAPRSRLG
SRGRPTRAGALKPEAGSSAHPRTLEELRLPPMSWNAPLDLSPRVVDGIEDGCGSDQPKFS
FRVGQSGPECSSSPSPGPESGLLTVPLGPSEARNTDTLDKLRQAVMELSEQVLQMREGLQ
SLRQAVHLVLAPQGEGLYPRASGEGPCRTSTSGLLQPLRVDTEASSYCLQPPAGSAISGT
WPHPRPGPPPLMAPWPWGPPASQSSPWPQATALWTSTSDSEPPGSGELCSEPSTPASPPP
EEGARPGPLETVSQAEATSTGEPPPGSGGQALPWDPHSLEMVLIGCHGPGTVQWTQEEGT
GV
Download sequence
Identical sequences G5AU18
HGL_H00000257981

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]