SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G5AUB3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5AUB3
Domain Number 1 Region: 356-488
Classification Level Classification E-value
Superfamily Ankyrin repeat 8.03e-25
Family Ankyrin repeat 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G5AUB3
Sequence length 489
Comment (tr|G5AUB3|G5AUB3_HETGA) KN motif and ankyrin repeat domain-containing protein 1 {ECO:0000313|EMBL:EHB00624.1} KW=Complete proteome; Reference proteome OX=10181 OS=Heterocephalus glaber (Naked mole rat). GN=GW7_08238 OC=Hystricomorpha; Bathyergidae; Heterocephalus.
Sequence
MTEADKEIELRQQIIEALKEKVYGQEVQLKETTHNRGMTKLKQELQAAGSRKKVDKAMTA
QPLVFSKLKLLVEQQTLLAENYSELTEAFEEPHSWIGSLNSQLISTLTSINSVMKSASTE
ELKNADFQKTSLGRIAGNNLEYTHKCGGLLSTQVFHPELKVGTEEGKPVSSQETLPSQER
TLALVNLTDDQVASGLYMCTNNESTPKSIMKKNSDESSSSKSDDECDVIEYPPEEKEEEE
ENEDTGEWWKGTMQLILKVSSLPGWTMKCRFKHVNLRRWKSERHELSKKMLSACNLLKNN
INDPKSLTSKYMMFYLNTLQHEWFLVFSQKSAVPAMVGDYTAAFEAVSPDVLCYIINMAN
AKGNTALHYSMAHSNFGIIKLLLDADVCNVDHQNKAGYTPIMLAALKAVEAEKDMWIVEE
LFGCGDMNTKASQVGQMALILAVSHGWTDMLKGLLACGADINIQGEKGSTALMCDSEHGH
AEIIKLLLA
Download sequence
Identical sequences G5AUB3
HGL_H00000371734-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]