SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G5AUP7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5AUP7
Domain Number 1 Region: 98-212
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 4.34e-27
Family Canonical RBD 0.00000772
Further Details:      
 
Domain Number 2 Region: 12-100
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.42e-25
Family Canonical RBD 0.00000902
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G5AUP7
Sequence length 236
Comment (tr|G5AUP7|G5AUP7_HETGA) Putative heterogeneous nuclear ribonucleoprotein A1-like protein 3 {ECO:0000313|EMBL:EHB00758.1} KW=Complete proteome; Reference proteome OX=10181 OS=Heterocephalus glaber (Naked mole rat). GN=GW7_15008 OC=Hystricomorpha; Bathyergidae; Heterocephalus.
Sequence
MSKSESPKESEQLRKLFIQGLSFETTDESLRSCFEQWGMLMDCVVMRDPNTKRSRGFGFV
TYATVEEVDAAMNARLHKVGGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHH
LRDYFEQCGKIEVIEIITDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKA
LLKQEMASASSSQRGRSGSGNFGGGRGGGFGGNDNFSWGGNFSGRGGFSGSHGGGG
Download sequence
Identical sequences G5AUP7
HGL_H00000383298-2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]