SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G5AV98 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5AV98
Domain Number 1 Region: 787-981
Classification Level Classification E-value
Superfamily Macro domain-like 5.72e-43
Family Macro domain 0.00013
Further Details:      
 
Domain Number 2 Region: 1619-1800
Classification Level Classification E-value
Superfamily ADP-ribosylation 4.51e-41
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.018
Further Details:      
 
Domain Number 3 Region: 1194-1390
Classification Level Classification E-value
Superfamily Macro domain-like 1.45e-40
Family Macro domain 0.00068
Further Details:      
 
Domain Number 4 Region: 1007-1187
Classification Level Classification E-value
Superfamily Macro domain-like 6.39e-40
Family Macro domain 0.00018
Further Details:      
 
Domain Number 5 Region: 1493-1601
Classification Level Classification E-value
Superfamily WWE domain 6.67e-19
Family WWE domain 0.0062
Further Details:      
 
Weak hits

Sequence:  G5AV98
Domain Number - Region: 221-292
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.000222
Family Canonical RBD 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G5AV98
Sequence length 1801
Comment (tr|G5AV98|G5AV98_HETGA) Poly [ADP-ribose] polymerase {ECO:0000256|RuleBase:RU362114} KW=Complete proteome; Reference proteome OX=10181 OS=Heterocephalus glaber (Naked mole rat). GN=GW7_19702 OC=Hystricomorpha; Bathyergidae; Heterocephalus.
Sequence
MAAPRSFPLLVEGSWGPDPPKNLSTKLQLYFQSPKRSGGGGECEVRRDPENPARFLVLFS
EDVRQKVLQKMNHELVLPGKGTFQLTVQLPTAPDEPPVSKEKISANESKMEENVKEPVVS
EEPDMELSLNSRSEKMEDLPKECENVSNLVAFENIKANMTDMMMTLLVENVSGLTSDDFQ
VEVIQDFSVAVVTFKKHTDTMKFVHDCARHHSIQQLKLFPRLLEETKTIRVENLPPGVDD
YQLQLFFENPFHGGGRVAHVECFPEESSALIEFCDRKVLDTIMTKKHNFNKMPLSVFPYY
TSLGTALYGEEQPLIKLPAPFQESLDLPLWKFFQKKDHLIKELDDEMRRHHCELTWSQLD
SKVTIRPAATLVNQGRLRIKTWQKDASTALYGIRSTYAVTSFKVAPVVWDIIKNDLEDDR
ILIEFDTSKETVTLAGKSEDIQNVHPQIKELLERTTQKIQREEQSLKEKVAISSEKHFLL
HHSGVLQHVCTECPEMEICYDADTQCLCLKGPQADVYKVKCEIQEKVYTMAKKTTEVSPE
VFQFLQQVDHKEFSKSFFIAQKNLTVYELKDTTVLLTSCSSEVLVEAEKQMLSALNYKRI
EVEDKTILTNNKWKKFIGNIQKKSNSSTCIMIISEFTVGSPAGVIVAGLVKEVNEIYSVI
FDFLEKNMKIERLIEIKPSLVIDYLKAEKKQFWSKIKKGDVQVVFNPEHNQKGILLIGPK
CQVLEGMNFVKEAEKSVFVKSIPIDKPGARQFFQDKAWFYRGEVRKLYGCFIELLENEEK
KVGGKTAGQKYLIQREVAPGIFLIVQQGDLTQFPVNIVVNAANEDLKHIAGLAAALSKAA
GPELQADCDKIVKRDGRLLPGNVVLSKAGKLPCQHVIHAVGPRWDGHEAPRCVYLLKKAV
ENSLLLAEKHKCRSGVFGFPLQQCVESIVLSIKENFQHRQDGWTLKEIYLVDSLEKTAEA
FAKAVTTIFKYPLPERSSPPNTVSQPSITSLHSGPAAKPVTTSQEMASLTAPGGLKILLV
KNGVQDATTHVVVNSIPSDLGLNRGPLSRALLEKAGPEIQKELYAAGQGITVDVGAILQT
SGCNLQCRHVLHVVTPSWTNDTSAQKIMEDIIRHCLEITERLSLQSIAFPAIGTGNLGFP
KTVLAELLLSEVLKFSSKMQLKTLQEVHFLVHPSDHENIQAFSVEFARRSNGNLNDTVPK
AEDDKQGFYGTISSPNLGVHEMKIGPILFQVASGDITKEAADVIVNSTSHKFNLKAGVSK
AILENAGQEVEQECALLGQQGKNEYIITKGGSLMCKNIIHVVGGSNVKRSVSCVLQETEK
RNYSSICLPAIGTGSAGQDQNKVAEAMLDAIEDFTQNGSVQYVKKVKVVIVQPQVLDVFY
ANMKKREGSRASHQPSMMSKFASFFGLSKPPHPKKKPLVLEKKTELAVFQLCGENSNCVD
QAILWLKDLITKEQYSYTNTDECMKDFDEKEYQELNELQKKLNITIFLDRKRPFIEVLGI
TRDVMEARDKIEEMVKKVRSAKEEENRADCISEFIEWQYCKDNTFHRFDKITNLQLEDAR
RAKNKSIVVKINNQSYTVNLKDFTARSPHGHSVTIQRFTKSEVDLPGHWSDMKQQNLCVV
QLQPGDTEFNTVAGTFNQTCSQFVIEKIERIQNPDLWNSYQAKKKIMDGKNGQVINEKLL
FHGTDVDSVPHVNGNGFNRSYAGKNAVAYGKGTYFAVSASYSANDTYSRPDANGKKHMYY
VRVLTGVYTNGNSSLIVPPSRDPQNPTDLYDTVTDNVHNPSLFVVFYDYQAYPEYLITFR
R
Download sequence
Identical sequences G5AV98
HGL_H00000418194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]