SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G5AVJ6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5AVJ6
Domain Number 1 Region: 97-142
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.000000718
Family Canonical RBD 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G5AVJ6
Sequence length 219
Comment (tr|G5AVJ6|G5AVJ6_HETGA) Nucleoporin NUP53 {ECO:0000313|EMBL:EHB01057.1} KW=Complete proteome; Reference proteome OX=10181 OS=Heterocephalus glaber (Naked mole rat). GN=GW7_12397 OC=Hystricomorpha; Bathyergidae; Heterocephalus.
Sequence
MMLGSPTSPKSGVNAQFLPGFLMGDLPAPVTPQPRSVSGSSVGVMEMRSPLLASGSPPQP
VVPAHKDKSGAPPVRSIYDDISSPGLGSTPLTSRRQMSNTGNWMHIRYQSKLQARKALSK
DGRIFGESIMIGVKPCIDKSVMENSDRGALSSSSLAFTPPIKTLGTPTQPGSTPRISTMR
PLATAYKASTSDYQVISDRQTPKKDESLVSKAMEYMFGW
Download sequence
Identical sequences G5AVJ6
HGL_H00000295119-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]