SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G5AVW7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5AVW7
Domain Number 1 Region: 2619-2993
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 2.35e-94
Family Regulator of chromosome condensation RCC1 0.0043
Further Details:      
 
Domain Number 2 Region: 3121-3469
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 1.02e-90
Family Hect, E3 ligase catalytic domain 0.0000532
Further Details:      
 
Domain Number 3 Region: 2049-2145,2202-2428
Classification Level Classification E-value
Superfamily WD40 repeat-like 5.95e-35
Family WD40-repeat 0.008
Further Details:      
 
Domain Number 4 Region: 648-830
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.94e-34
Family SPRY domain 0.01
Further Details:      
 
Weak hits

Sequence:  G5AVW7
Domain Number - Region: 366-613
Classification Level Classification E-value
Superfamily ARM repeat 0.000832
Family HspBP1 domain 0.054
Further Details:      
 
Domain Number - Region: 1366-1428
Classification Level Classification E-value
Superfamily UBA-like 0.00438
Family UBA domain 0.013
Further Details:      
 
Domain Number - Region: 886-930
Classification Level Classification E-value
Superfamily Troponin coil-coiled subunits 0.0924
Family Troponin T 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G5AVW7
Sequence length 3493
Comment (tr|G5AVW7|G5AVW7_HETGA) Putative E3 ubiquitin-protein ligase HERC1 {ECO:0000313|EMBL:EHB01178.1} KW=Complete proteome; Reference proteome OX=10181 OS=Heterocephalus glaber (Naked mole rat). GN=GW7_10969 OC=Hystricomorpha; Bathyergidae; Heterocephalus.
Sequence
VLHVTEIFQCFLSAREVARSRDRDRMNSEAGSGARVDDPPPQSQQERRVSTDLPEGQDVY
TAACNSVIHRCALLILGVSPVIDELQKRREEGQLQQPSTSASEGGGLMTRSESLTAESRL
VHASPNYRLIKSRSESDLSQPESDEEGYTLSGRRNVDLDLASSHKKRGPMHSQLESLSDS
WVHLKHSRDWLYNSSYSFESDFDLTQSLGVHTLIENVVSFVSGDVGNTPGFKEPEESMST
SPQASIIAMEQQQLRAELRLEALHQILVLLSGMEEKGSLSLAGSRSSSGFHSSTLLTSVR
LQFLAGCFGLGTVGHLGTKGESGRLHHYQDGIRAAKRSIQIEIQVAVHKIYQQLSATLER
ALQANKHHIEAQQRLLLVTVFALSVHYQPVDVSLAISTGLLNVLSQLCGTDTMLGQPLQL
LPKTGVSQLSTALKVASTRLLQILAITTGTYADKLSPKVVQSLLDLLCSQLKNLLSQTGV
LLMASFGEGEGEEGEEEEKKVDSSEETEKKDFRAALRKQHAAELHLGDFLVFLRRVVSSK
AIQSKMASPKWTEVLLNIASQKCSSGIPLVGNLRTRLLALHVLEAVLPACESGVEDDQMA
QVVERLFSLLSDCMWETPIAQAKHAIQIKEKEQEIKLQKQGELEEEDENLPIQEVSFDPE
KAQCCLVENGQVLTHGSGGKGYGLASTGVTSGCYQWKFYIVKENRGNEGTCVGVSRWPVH
DFNHRTTSDMWLYRAYSGNLYHNGEQTLTLSSFTQGDFITCVLDMEARTISFGKNGEEPK
LAFEDVDAAELYPCVMFYSSNPGEKVKICEMQMRGTPRDLLPGDPICSPVAAVLAEATTQ
LIRILHRTDRWTYSINKKMMERLHKIKICIKESGQKLKKSRSVQSREENEMKEEKENKEE
EKGKHNRHGLADLSEPQLRTLCTEVWPVLAVIGGVDAGLRVGGRCVHKQTGRHATLLGVV
KEGSTSAKVQWDEAEITISFPTFWSPSDTPLYNLEPCEPLPFDVARFRGLTASVLLDLTY
LTGIHEDMGKQSAKRHEKKHRHESEEKGDSEQKPESESALDVRTGLASDDVKGQGATSSK
SENEIASFSLEPTLPGVESQHPITEGKRKNHEHMSKNHDVAQSEIRAVQLSYLYLGAMKS
LSALLGCSKYAELLLIPKVLTENGHNSDCASSPVVHEDVEMRAALQFLMRHMVKRAVMRS
PIKRALGLADLERAQAMIYKLVVHGLLEDQFGGKIKQEVDQQAEESDQAQQAQTPVTTSP
SASSTTSFMSSSLEDTTTATTPVTDTETVPASESPGVMPLSLLRQMFSSYPTTTVLPTRR
AQTPPISSLPTSPSDEVGRRQSLTSPDSQSARPANRTALSDPSSRLSTSPPPPAIAVPLL
EMGFSLRQIAKAMEATGARGEADAQNITVLAMWMIEHPGHEDEEDPQPGSTADARHGAAV
LGSGGKSNDPCYLQSPGDIPSADAAEMEEGFTESPDNLDHTENAASGSGPPTRGRSAVTR
RHKFDLAARTLLARAAGLYRSVQAHRNQSRREGISLQQDPGALYDFNLDEELEIDLDDEA
MEAMFGQDLTSDNDILGMWIPEVLDWPTWRVCESEDREEVVVCELCECSVISFNQHMKRN
HPGCGRSANRQGYRSNGSYVDGWFGGECGSGNPYYLLCGSCREKYLALKTKSKTTSSERY
KGQAPDLIGKQDSVYEEDWDMLDVDEDEKLTGEEEFELLAGPLGLNDRRIVPEPVQFPDS
DPLGASVAMVTATNSMEETLMQIGCHGSVEKSSSGRITLGEQAAALVNPHDRVVALRRVT
AAAQVLLARTMVMRALSLLSVRQVLGSSCSLAAGLESLGLTDIRTLVRLMCLAAAGRAGL
STSPSATTSFSERSRGGHSKANKPISCLAYLSTAVGCLASNTPSAAKLLVQLCTQNLISA
ATGVNLTTVDDPIQRKFLPSFLRGIAEENKLVTSPNFVVTQALVALLADKGAKLRPNYDK
SEVEKKGPLELANALAACCLSSRLSSQHRQWAAQQLVRTLAAHDRDNQTAPQTLADMGGD
LRKCSFIKLEAHQNRVMTCVWCNKKGLLATSGNDGTIRVWNVTKKQYSLQQTCVFNRLEG
DAEDSLGSPSDPSFSPVSWSISGKYLAGALEKMVNIWQVNGGKGLVDIQPHWVSALAWPE
EGPAAAWSGESAELLLVGRMDGSLGLIEVVDVSTMHRQELEHCYRKDVSVTCIAWFSEDR
QFAVGYFDGKLLLGTKEPLEKGGIVLIDAHKDTLVGMKWDPTGHILMTCAKEENVKLWGP
ISGCWRCLHSLCHPSIVNGIAWCSLPGKGSKLQLLMATGCQNGLVCVWRIPQDTTQTSVT
SSEGWWDQESHCRDGYRKLAGAKCVYQLRGHITPVRTVAFSSDGLALVSGGLGGLMNIWS
LRDGSVLQTVVIGSGAIQTTVWIPEVGVAACSNRSKDVLVVNCTAEWAAGNHVLATCRTA
LKQQGVLGLNMAPCMRAFLERLPMMLQEQYSYEKPHVVCGDQLVHSPYMQCLASLAVGLH
LDQLLCSPPVPPHHQNCLPDPAFWNPNEWAWLECFSTTIKAAEALTNGAQFPESFTVPDL
EPVPEDELVFLMDNSKWINGMDEQIMSWATSRPEDWHLGGKCDVFLWGAGRHGQLAEAGR
NVMVPAAAPSFSQAQQVICGQNCTFVIQANGTVLACGEGSYGRLGQGNSDDLHVLTVISA
LQGFVVTQLVTSCGSDGHSMALTESGEVFSWGDGDYGKLGHGNSDRQRRPRQIEALQGEE
VVQMSCGFKHSAVVTSDGKLFTFGNGDYGRLGLGNTSNKKLPERVTALEGYQIGQAWNKS
YSVACGLNHTLAVSTDGSMVWAFGDGDYGKLGLGNSTAKSSPQKVDVLCGIGIKKVACGT
QFSVALTKDGHVYTFGQDRLIGLPEGRARNHNRPQQVPVLAGVVIEDVAVGAEHTLALAS
TGDVYAWGSNSEGQLGLGHTNHVREPTLVTVLQGKNIRQISAGRCHSAAWTAPPVPPRAP
GVSVPLQLGLPDAVPPQYGALREVSIHTVRARLRLLYHFSDLMYSSWRLLNLSPNNQNST
SHYNAGTWGIVQGQLRPLLAPRVYTLPMVRSIGKTMVQGKNYGPQITVKRISTRGRKCKP
IFVQIARQVVKLNASDLRLPSRAWKVKLVGEGADDAGGVFDDTITEMCQELETGVVDLLI
PSPNATAEVGYNRDRFLFNPSACLDEHLMQFKFLGILMGVAIRTKKPLDLHLAPLVWKQL
CCVPLTLEDLEEVDLLYVQTLNSILHIEDSGITEESFHEMIPLDSFVGQSADGKMVPIIP
GGNSIPLTFSNRKEYVERAIEYRLHEMDRQVAAVREGMSWIVPVPLLSLLTARQLEQMVC
GMPEISVEVLKKVVRYREVDEQHQLVQWFWRTLEEFSNEERVLFMRFVSGRSRLPANTAD
ISQRFQIMKVDRPYDSLPTSQTCFFQLRLPPYSSQLVMAERLRYAINNCRSIDMDNYMLS
RNVDNAEGSDTDY
Download sequence
Identical sequences G5AVW7
HGL_H00000261887

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]