SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G5AWI1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5AWI1
Domain Number 1 Region: 10-303
Classification Level Classification E-value
Superfamily Glutaminase/Asparaginase 7.33e-90
Family Glutaminase/Asparaginase 0.000000135
Further Details:      
 
Domain Number 2 Region: 345-495
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.13e-28
Family Ankyrin repeat 0.00097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G5AWI1
Sequence length 506
Comment (tr|G5AWI1|G5AWI1_HETGA) 60 kDa lysophospholipase {ECO:0000313|EMBL:EHB01392.1} KW=Complete proteome; Reference proteome OX=10181 OS=Heterocephalus glaber (Naked mole rat). GN=GW7_18876 OC=Hystricomorpha; Bathyergidae; Heterocephalus.
Sequence
SCSPACPDQRVIYTVLERQPLLDSSDMTITEWVQVAQIVERHYEQYHGFVVVHGTDTMAF
AASVLSFVLENLHKPVILTGAQVPIHALWNDGRENLLGALLMAGQYIIPEVCLFFQNQLF
RGNRATKVDTQRFGAFCSPNLPPLATVGTDVTVSWELVRKVSREDQLVVHSSVEHNVGLL
RLYPGIPASLVRAFLQPPLKGVVLETFGSGNGPTKPDLLQELRAAAERGLILVNCTHCLQ
GAVTPGYAAGLASVGAGIVSGFDMTSEAALAKLSYVLGRPGLSLDDRKQLLAKDLRGEMT
LPTVDKHQSPLQGSKLGHSVAWLLGLSGSQEADAVRDTLVPSLALAAAHAGDLEALQALV
ELGSGLCLQDPNGQTLLHAAARRGHVGAVTMLLRRGVDVSARDQDGLTPLLLAVRGRHWG
VIQLLRAAGACLSPQDLEDAGTELCRLASRADTEGLRAWCQAGADLEQPGYDGRSALRVA
EAAGNLEVVALLQSLEGAGHVSPPAP
Download sequence
Identical sequences G5AWI1
HGL_H00000299234

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]