SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G5AWL8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5AWL8
Domain Number 1 Region: 98-214
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00000942
Family Voltage-gated potassium channels 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G5AWL8
Sequence length 273
Comment (tr|G5AWL8|G5AWL8_HETGA) Voltage-gated hydrogen channel 1 {ECO:0000313|EMBL:EHB01429.1} KW=Complete proteome; Reference proteome OX=10181 OS=Heterocephalus glaber (Naked mole rat). GN=GW7_03094 OC=Hystricomorpha; Bathyergidae; Heterocephalus.
Sequence
LAPWLPFQAVTHRARVAPAERMSRFLRHFTVAGDDFHSWNINYKKWENEEEEEEEEEQQQ
PPPAPASGEEGRSAEAASVPGPRAPLDFRAKLRKLFHSHRFQVIIICLVVLDALLVLAEL
ILDLKIIKADKNKYAAQVFHWMSLAILAFFMMEIFFKIFVFRLEFFHHKFEILDTVVVVV
SFVLDIVLLFKEHEFEALGLLILLRLWRVARIINGIIISVKSRSERQLLRLKQMNIQLAT
KIQHLEFSCTEKEQEIERLNKLLRQHGLLGEVN
Download sequence
Identical sequences G5AWL8
HGL_H00000242607

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]