SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G5AX58 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  G5AX58
Domain Number - Region: 196-241,316-332
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00102
Family Canonical RBD 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G5AX58
Sequence length 335
Comment (tr|G5AX58|G5AX58_HETGA) Transmembrane protein 63A {ECO:0000313|EMBL:EHB01619.1} KW=Complete proteome; Reference proteome OX=10181 OS=Heterocephalus glaber (Naked mole rat). GN=GW7_20275 OC=Hystricomorpha; Bathyergidae; Heterocephalus.
Sequence
MIDSPLLELWWPETVSIREGLGLGDKANDSYCYNSAQNSTVLQGVTFGGIPTVLLIDVCC
FLGCCPWLMAIFRLHDDQIRERCGEDAVHYLSFQRHLIFLLVAVSALSLCIILPVNLSGD
LLDKDPYSFGRTTIANLETHNDLLWLHAVFAVIYLSLTVGFMRHHTQSIKYTEETLLLSC
KGRSFSCFGDGSFIADKDSVRRTLFISGIPRDAKEENVERHFWDAYPTCEVADIQLCYNV
AKLIYLCEERKKTEKSLAYYTSLQERTGQPTFVHSRPCGQFCCCEGWGCEQEDTIAYYTR
LYNQLLTRITEEERQVQGQPLGMAFVTLREKSMAT
Download sequence
Identical sequences G5AX58
HGL_H00000355800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]