SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G5AZA7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5AZA7
Domain Number 1 Region: 10-319
Classification Level Classification E-value
Superfamily WD40 repeat-like 3.48e-33
Family WD40-repeat 0.0079
Further Details:      
 
Domain Number 2 Region: 483-619
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.00000000118
Family Cell cycle arrest protein BUB3 0.033
Further Details:      
 
Weak hits

Sequence:  G5AZA7
Domain Number - Region: 851-947
Classification Level Classification E-value
Superfamily ARM repeat 0.00558
Family Clathrin heavy chain proximal leg segment 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G5AZA7
Sequence length 1173
Comment (tr|G5AZA7|G5AZA7_HETGA) WD repeat-containing protein 35 {ECO:0000313|EMBL:EHB02372.1} KW=Complete proteome; Reference proteome OX=10181 OS=Heterocephalus glaber (Naked mole rat). GN=GW7_11040 OC=Hystricomorpha; Bathyergidae; Heterocephalus.
Sequence
QITIPNSVKLKCISWNKDQGFIACGGEDGLLKVLKLETQTDDAKLRGLAAPSNLSMNQTL
EGHSGSVQVVAWNEQYQKLTTSDQNGLIIVWMLYKGSWYEEMINSRNKSVVRSMSWNADG
QKICIVYEDGAVIVGSVDGNRIWGKELKGIQLCHVAWSTDSKILLFGMANGEIHVYDNQG
NFIIKMRLSCLVNVTGAISIAGIHWYHGTEGYVEPDCPCLAICFDNGRCQIMRHENDRNP
VLIDTGMHVVSIQWNHTGSVLAVAGSQKVVTQDKDVNTVQFYTPFGEHLGTLKVPGKRMS
ALSWEGGGLKIALAVDSFIYFANIRPDYKWGYCSNTVVYAYTTPDRPEYCVVFWDTKNNE
KYVKYVKSLISVTTCGDFCILATKADESHPQVGILQCTEAQFVLVLCNSIGTPLDPKYID
IVPLFVTMTKTHVIAASKEAFYIWQYRVAKKLMALEINQITRPRREGRERVYHVDDTPSA
SVDGVPDYSKAIQGTRDPICAITASDKTLIVGRESGTIQRYSLPNVGLIQKYFLNCRAYR
LSLNCNSSRLAIIDISGVLTFFDLDSRAMDSTGQQVIGELLKLERKDVWDMKWAKDNPDL
FAMMEKTRMYVFRNLDPEEPIQTSGYICNFEDLEIKSVLLDEILKDPEHPNKDYMLNFEI
RSLRDSRALLEKVGIEDASQFIEDNPHPRLWRLLAEAALQKLDLCTAEQAFVRCEDYQGI
KFVKRLGNLQSEAMKQAEVVAYFGRFEEAERMYLDMDRRDLAIGLRLKLVDWFRVLHLLK
TGSGVADDSLLEQAHNAIGDYFADRQKWLNAVEYYVQGRNQERLAECYYMLEDYEGLESL
ASSLPENHKLLPDIAQMFVRVGMCGQAVTAFLRCNQPKAAVDTCVHLHQWNKAVELAKSH
NMKEIGSLLARYASHLLEKNKTLEAIELYRKASYFFDAAKLMFKIADEEAKKRAKPLRVK
KLYVLAALLVQQHQEQVKSAQRGKAGGESSEAASALAGFLEEEVLPTAGRFTDSAWRGAE
AYHFFVLAQRQLYEGYVDTALQTAFHLRDYEDIIPAVEIYSLLALCACASRAFGTCSKAF
IKLESLETLSSEQKQQYEDLALEIFTKHTPKDNRKSELDSLLEGGEGKLPTCVATGRPIT
EYQFWMCSVCRHCVHAQEISSCAFCPLCHSAVG
Download sequence
Identical sequences G5AZA7
HGL_H00000314444-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]