SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G5B2N0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5B2N0
Domain Number 1 Region: 120-223
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 7.12e-26
Family Canonical RBD 0.00000952
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G5B2N0
Sequence length 422
Comment (tr|G5B2N0|G5B2N0_HETGA) RNA binding protein fox-1 homolog {ECO:0000256|PIRNR:PIRNR037932} KW=Complete proteome; Reference proteome OX=10181 OS=Heterocephalus glaber (Naked mole rat). GN=GW7_19989 OC=Hystricomorpha; Bathyergidae; Heterocephalus.
Sequence
MQHPLTGATCVALPNVGMCPQLSCALTFMYLQQGNQEAAAAPDTMAQPYASAQFAPPQNG
IPAEYTAPHPHPAPEYTGQTTVPEHTLNLYPPAQSHSEQSAADNSAQTVSGTATQTDDAA
PTDGQPQTQPSENTENKSQPKRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGSK
GFGFVTFENSADADRAREKLHGTVVEGRKIEVNNATARVMTNKKTVNPYTNGWKLNPVVG
AVYSPEFYAGTVLLCQANQEGSSMYTAPSSLVYTSAMPGFPYPAATAAAAYRGAHLRGRG
RAVYNTFRAAAPPPPIPAYGGVVYQEPVYGNKLLQGGYAAYRYAQPTPATAAAYSDSYGR
VYAADPYHHTLAPAPTYGVGAMNAFAPLTDAKTRSHADDVGLVLSSLQASIYRGGYNRFA
PY
Download sequence
Identical sequences G5B2N0
HGL_H00000309117

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]