SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G5B6C2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5B6C2
Domain Number 1 Region: 1559-1687
Classification Level Classification E-value
Superfamily PRC-barrel domain 2.35e-54
Family RIKEN cDNA 2310057j16 protein (KIAA1543) 0.00000499
Further Details:      
 
Domain Number 2 Region: 1810-1908
Classification Level Classification E-value
Superfamily PRC-barrel domain 3.06e-41
Family RIKEN cDNA 2310057j16 protein (KIAA1543) 0.0000354
Further Details:      
 
Domain Number 3 Region: 1740-1814
Classification Level Classification E-value
Superfamily PRC-barrel domain 7.77e-30
Family RIKEN cDNA 2310057j16 protein (KIAA1543) 0.0001
Further Details:      
 
Weak hits

Sequence:  G5B6C2
Domain Number - Region: 377-433
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00356
Family Calponin-homology domain, CH-domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G5B6C2
Sequence length 1997
Comment (tr|G5B6C2|G5B6C2_HETGA) Calmodulin-regulated spectrin-associated protein 1 {ECO:0000313|EMBL:EHB04833.1} KW=Complete proteome; Reference proteome OX=10181 OS=Heterocephalus glaber (Naked mole rat). GN=GW7_16584 OC=Hystricomorpha; Bathyergidae; Heterocephalus.
Sequence
MVPSLPQDPAVSGCAGVWEARHWGAMGSCVRLADPCRGVEWSWLKCVALDNIPEDLRDPF
YIDQYEQEHIKPPVIKLLLSSELYCRVCSLILKGDQAATLQGHQSVIQALSRKGIYVMES
DDTPVTDADLGHAPVKMSAHMAMVDALMMAYTVEMISIEKVVASVKRFSTFSASKELPYD
LEDAMVFWINKVNLKMREITEKEVKLKQQLLESPAHQKVRYRREHLSARQSPYFPLLEDL
MRGGSDGAALLAVVHYYCPEQMRLDGRRPTTTGACPVASVLRPPPDLGVAGDPNPNEHQV
TEAVQEKQHRGSPVPQRGQQVPHIFMEEALDLVLALFVTVSWTPLGRHWQGLCEGLAADW
KLLFSHKQQGLDICLKEVPSMADSLYNIRLLREFASEHLNKCFYLTLEDMLYAPLVLKPN
VMVFIAELFWWFENVKPDFVQPRDVQELKDAKAVLPQKSSRPPVQISNATKRSFLGSPAA
LSPADLPPASLPAEGGRRYHLLPEEAECLGKGTSAFSSSHPLLPLRQKQQKAAQAEETPD
QRHRSNSLTRVDGQPRGAAVAWPEKKARPVSQPTPFAVHHATSCEVDPGSGDSISLARSI
SKDSLASNIVHLTPQNQPHPAAGKANGKSLLSNVSIEDEEEELVAIIRTDATAHRGDLEV
ARASPRAPSLLASARSPQRQLDLMESKPDSFFLEPLMPAVLRPAKEKQIITKEDECGEGR
PRSSTARRASKGPQLLARKKATGSHGHGGRDLNRTFTPIPCLEFLAGVDPAEASLLWADA
VGEVRGGPLAVSGFQPSPQGQAADGFFLHVGRADEDTEGRLCISSKSPSSQDSEPWTLLR
QDSESDVVDIEDTEQDFIGGDHPVVITTYAGEEESAKLQEDMKVREHEDKDGASGRSSPC
LSTASQLSSVSLASGSVKMTSFAERKLQRLNSYETKSSTSSSQKTTPDASESCPVPLTTW
RQKREQSPGRHGKDPASLLASELVQLHMQLEEKRRAIEAQKQKMEALSARQRLKLGKAAF
LHVVKKGRVDGAPQPLRPEHFVKEYSQHNGEHLDGSPPRTEHLSESRDTDADADGESLAL
APPHRPRDVAILHDVDKSKMISAGLLEDGVGEGVDVTECELSIEKLNETISTLQQAILKI
SQQQEQLLMKSPTVPTPSSKSNSQDQKVKAAIHFVEPLSPPGMAGHRKLPRLGQGRNSRS
GRPAELKVPKDRQLGSSRSKTPTPSVESLPHLRPFPPGHPPHLPSDPGMDGAADPGGHPE
KGLFDSYRLHDESNQRTCVLPSPKDPNIIAEHIGLREVLGASMKEAGLSSASRELLPMKE
IVPGEEPLRSKASLIEVDLAHLKAPDEDGELAGQDSAPELVSDGDQKPGVGFFFKDEQKA
EDELAKKRAACRLKQQRKAEEARVRKQQLEAEVELKRDEARRKAEEDRIRKEEEKARREL
IKQEYLRRKQQQILEEQGLSKPKSKPRKPRPKSVHREESCSDSGTKCSSTPDNLSGTHSG
SSLSLASAATTEPESIHSGGTPSQRVESLEALPILSRNPSRSTDRDWETASAGSSLASVA
EYTGPKLFKEPSSKSNKPIIHNAVSHCCLAGKELEKCDANHYIILFRDAGCQFRALYCYY
PDTEEIYKLTGTGPKSITKKMIDKLYKYSSDRKQFNLIPAKTMSVSVDALTIHNHLWQPK
RPAVPKKTQPLFVGHMVMVMILSSGWALVPSQHGVPTLGLPRERILSIPRASDTGVVFSW
DELEKCDANHYIILFRDAGCQFRALYCYYPDTEEIYKLTGTGPKSITKKMIDKLYKYSSD
RKQFNLIPAKTMSELEKCDANHYIILFRDAGCQFRALYCYYPDTEEIYKLTGTGPKSITK
KMIDKLYKYSSDRKQFNLIPAKTMSVSVDALTIHNHLWQPKRPAVPKKTQPRQQPEQVRP
PRARVFPSLPLKTLPHLEVSDGHLREPGLQGLRAGAILRLCCVELTVAPADSLRGCFPPE
RCEAPEGTGGSRVCGLP
Download sequence
Identical sequences G5B6C2
HGL_H00000386420

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]