SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G5B6Q1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5B6Q1
Domain Number 1 Region: 30-62,114-182
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.96e-23
Family Voltage-gated potassium channels 0.0057
Further Details:      
 
Domain Number 2 Region: 198-302
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.88e-20
Family Voltage-gated potassium channels 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G5B6Q1
Sequence length 417
Comment (tr|G5B6Q1|G5B6Q1_HETGA) Potassium channel subfamily K member 4 {ECO:0000313|EMBL:EHB04928.1} KW=Complete proteome; Reference proteome OX=10181 OS=Heterocephalus glaber (Naked mole rat). GN=GW7_20673 OC=Hystricomorpha; Bathyergidae; Heterocephalus.
Sequence
TTAPQEPPAPPPPSAGSNGTGGTGPAPGRAMRSTTLLALLALVLLYLVSGALVFQALEQP
YEKQAQKDLGEVREKFLRAHPCVSQHELGLFIKEVADALGGGADPETNSTSISNHSAWNL
GSAFFFSGTIITTIGYGNAALRTDAGRLFCIFYALVGIPLFGILLAGVGDRLGSSLRRGI
GHIEAIFLKWHVPPELVRVLSAMLFLPIXGCLLFVLTPTFVFCYMEDWSKLEAIYFVIVT
LTTVGFGDYVAGADPKQESPAYQPLVWFWILLGLAYFASVLTTIGNWLRAVSRRTRAEMG
GLTAQAASWTGTVTARVTQRAVSTAPPPEKERPPLPPPPFSLPQCPPPPERVDTPSPPTA
SALDYPGENLAFIDESSDTQSERGCGLPRAPRGRRRPNPPRKPARPRGPGRPRDKGL
Download sequence
Identical sequences G5B6Q1
HGL_H00000402797

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]