SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G5B7S7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5B7S7
Domain Number 1 Region: 47-149
Classification Level Classification E-value
Superfamily POZ domain 2.55e-17
Family Tetramerization domain of potassium channels 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G5B7S7
Sequence length 250
Comment (tr|G5B7S7|G5B7S7_HETGA) BTB/POZ domain-containing protein KCTD20 {ECO:0000313|EMBL:EHB05338.1} KW=Complete proteome; Reference proteome OX=10181 OS=Heterocephalus glaber (Naked mole rat). GN=GW7_17989 OC=Hystricomorpha; Bathyergidae; Heterocephalus.
Sequence
MMPLPEDIKGSCFQSGGKRNHEPFLAPERFGNSSVGFGSNGHSQAPEKVTLLVDGARFVV
NPQIFAAHPDTMLGRMFGPGREYNFTRPNEKGEYEIAEGISATVFCMVLDYYKTGIINCP
DGISIPDLRETCDYLCINFDFNTIRCQDLSALLHELSNDGAHKQFDHYIEELVLPIMAGY
AKKDVMGKEEGKSRHVDFQCVQSKSLTNLVGAGQDVLEDPEMLMHHPPQVDELDRLNAPL
VQMASHDFQD
Download sequence
Identical sequences G5B7S7
HGL_H00000362836-2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]