SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G5B863 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5B863
Domain Number 1 Region: 71-150
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 4.74e-20
Family Smg-4/UPF3 0.0000771
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G5B863
Sequence length 189
Comment (tr|G5B863|G5B863_HETGA) Regulator of nonsense transcripts 3A {ECO:0000313|EMBL:EHB05474.1} KW=Complete proteome; Reference proteome OX=10181 OS=Heterocephalus glaber (Naked mole rat). GN=GW7_12919 OC=Hystricomorpha; Bathyergidae; Heterocephalus.
Sequence
MAASAVCPAAGRVGTQGLLLTGRSPGLLLSRRYETEKNSEAGYIVEHLAFKGTKNQPGNS
LEKWSHGSCPPGGLTKEQLEEQLRPLPAQDYFQVPGADRLLYPHLYSRACINFRNPDDIL
LFRDRFDGYVFMSSKGLEYPAVVEFAPFQKIVRRKLKKRDTKMGSIEDDPEYTVFRNLQH
GRRENQCQP
Download sequence
Identical sequences G5B863
HGL_N10006621

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]