SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G5B8A9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5B8A9
Domain Number 1 Region: 171-368
Classification Level Classification E-value
Superfamily E set domains 9.33e-75
Family Cytoplasmic domain of inward rectifier potassium channel 0.00000141
Further Details:      
 
Domain Number 2 Region: 69-187
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.67e-22
Family Voltage-gated potassium channels 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G5B8A9
Sequence length 434
Comment (tr|G5B8A9|G5B8A9_HETGA) ATP-sensitive inward rectifier potassium channel 14 {ECO:0000313|EMBL:EHB05512.1} KW=Complete proteome; Reference proteome OX=10181 OS=Heterocephalus glaber (Naked mole rat). GN=GW7_05355 OC=Hystricomorpha; Bathyergidae; Heterocephalus.
Sequence
MGLARALRRLSGALEPGDSRAGGEEEAGPGLCRNGWAPAQGPGTRRRGRLVKKDGHCNVR
FVNLGGQGARYLSDLFTTCVDVRWRWMCLLFSCSFLASWLLFGLAFWLIASLHGDLAAPP
PPAPCFSHVASFLAAFLFALETQTSIGYGVRSVTEECPAAVAAVVLQCIAGCVLDAFVVG
AVMAKMAKPKKRNETLVFSENAVVALRDRRLCLMWRVGNLRRSHLVEAHVRAQLLQPRVT
PEGEYIPLDHQDVDVGFDGGTDRIFLVSPITIVHKIDSASPLYELGRAELARADFELVVI
LEGMVEATAMTTQCRSSYLPGELLWGHRFEPVLFQHGSQYEVDYRHFHRTYEVPGTPVCS
AKELDERAEQAAHSPKSSFPGSLAAFCYENELALTCCQEEDEEEETKEGTGAETEDGAAS
PQVLTPTLALSLLP
Download sequence
Identical sequences G5B8A9
HGL_H00000341479

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]