SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G5B8L4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5B8L4
Domain Number 1 Region: 94-185,331-378
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.63e-28
Family Canonical RBD 0.0017
Further Details:      
 
Domain Number 2 Region: 4-90
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.75e-20
Family Canonical RBD 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G5B8L4
Sequence length 381
Comment (tr|G5B8L4|G5B8L4_HETGA) CUG-BP-and ETR-3-like factor 3 {ECO:0000313|EMBL:EHB05625.1} KW=Complete proteome; Reference proteome OX=10181 OS=Heterocephalus glaber (Naked mole rat). GN=GW7_10308 OC=Hystricomorpha; Bathyergidae; Heterocephalus.
Sequence
MKEPDAIKLFVGQIPRHLEEKDLKPIFEQFGRIFELTVIKDKYTGLHKGCAFLTYCARDS
ALKAQSALHEQKTLPGMNRPIQVKPADSESRGEDRKLFVGMLGKQQTDEDVRKMFEPFGT
IDECTVLRGPDGTSKGCAFVKFQTHAEAQAAINTLHSSRTLPGASSSLVVKFADTEKERG
LRRMQQVATQLGMFSPIALQFGAYSAYTQALMQQQAALVAAHSAYLSPMATMAAVQMQHM
AAINANGLIATPITPSSGTSTPPAIAATPVSAIPAALGVNGYSPVPTQPTGQPAPDALYP
NGVHPYPGPLMSMLLSPAQSPAAPVDPLQQAYAGMQHYTGFVSFDNPASAQAAIQAMNGF
QIGMKRLKVQLKRPKDANRPY
Download sequence
Identical sequences G5B8L4
HGL_H00000402503

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]