SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G5BA93 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5BA93
Domain Number 1 Region: 187-270,567-747
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 3.71e-38
Family Diacylglycerol kinase-like 0.014
Further Details:      
 
Domain Number 2 Region: 945-1011
Classification Level Classification E-value
Superfamily SAM/Pointed domain 5.57e-19
Family SAM (sterile alpha motif) domain 0.0039
Further Details:      
 
Domain Number 3 Region: 89-157
Classification Level Classification E-value
Superfamily Cysteine-rich domain 4.34e-17
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.000051
Further Details:      
 
Domain Number 4 Region: 28-84
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000314
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G5BA93
Sequence length 1019
Comment (tr|G5BA93|G5BA93_HETGA) Diacylglycerol kinase {ECO:0000256|RuleBase:RU361128} KW=Complete proteome; Reference proteome OX=10181 OS=Heterocephalus glaber (Naked mole rat). GN=GW7_02715 OC=Hystricomorpha; Bathyergidae; Heterocephalus.
Sequence
MEDWISSLKSVQTREPYEVAQFNVEHFSGMHNWYACSHARPTFCNVCRESLSGVTSHGLS
CEVCKFKAHKRCAVRATNNCKWTTLASIGKDIMEDEDGVAMPHQWLEGNLPVSAKCAVCD
KTCGSVLRLQDWKCLWCKTMVHTACKDLYHPVCPLGQCKVSIIPPIALNSTDSDGFCRAT
FSFCVSPLLVFVNSKSGDNQGVKFLRRFKQLLNPAQCQLGVLPLGTGNDLARVLGWGGSY
DDDTQLPQILEKLERASTKMLDRWSIMTYELKLPPKASLLPEPPEAPEEFYMTIYEDSVT
THLSKILNSDEHAVVISSAKILCETVKDFVAKVEKAYDKTFENAVVAEAVATKCSVLNEK
LEQLLQALHTDFQAAPTLPGIGAVILEEDVVESSSEESLGESKDQLAEDITKSSSQKAIK
PREIMLRANSLKKAVRQVIEEAGKVMDDQTVICTDYDSIETDESKEESKEDSRESLTVKA
APRSPDARASRGHSQTDSLPGPAVTATKENLPVLNTRIICPGLRAGLAASIAGSSIINKM
LLANSDPFGATPFIDPDLDSLDGYSEKCVMNNYFGIGLDAKISLEFNNKREEHPEKCRSR
TKNLMWYGVLGTRELLQRSYKNLEQRVQLECDGQYIPLPSLQGIAVLNIPSYAGGTNFWG
GTKEDDIFAAPSFDDKILEVVAIFDSMQMAMSRVIKLQHHRIAQCRTVKITIFGDEGVPV
QVDGEAWVQPPGIIKIVHKNRAQMLTRDRAFESTLKSWEDKQKCDSGKQVLRTHLYIQHA
VDLATEEVLQMQLCSQAAEELITRICEAATIHCLLEQELAHAVNACSHALNKANPRCPES
LTRDTATEIAINVKALYNETESLLVGRVPLQLESPHEERVSSALHSVEVELQKLTEIPWL
YYILHPNENEEPPMDCTKRNNRSTVFRIVPKFKKEKVQKQKTSSQPVQKWGTEEVAAWLD
LLSLGEYKEIFIRHDIRGAELLHLERRDLKDLGIPKVGHMKRILQGIKELGRSTPQSEV
Download sequence
Identical sequences G5BA93
HGL_H00000337572-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]