SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G5BAN1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5BAN1
Domain Number 1 Region: 482-668
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.49e-42
Family cAMP-binding domain 0.002
Further Details:      
 
Domain Number 2 Region: 190-292,324-378,417-479
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.31e-41
Family Voltage-gated potassium channels 0.0023
Further Details:      
 
Domain Number 3 Region: 13-109
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.27e-19
Family Flavin-binding PAS domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G5BAN1
Sequence length 958
Comment (tr|G5BAN1|G5BAN1_HETGA) Potassium voltage-gated channel subfamily H member 1 {ECO:0000313|EMBL:EHB06342.1} KW=Complete proteome; Reference proteome OX=10181 OS=Heterocephalus glaber (Naked mole rat). GN=GW7_02931 OC=Hystricomorpha; Bathyergidae; Heterocephalus.
Sequence
DTNFVLGNAQIVDWPIVYSNDGFCKLSGYHRAEVMQKSSTCSFMYGELTDKDTVEKVRQT
FENYEMNSFEILMYKKNRTPVWFFVKIAPIRNEQDKVVLFLCTFSDITAFKQPIEDDSCK
GWGKFARLTRALTSSRGVLQQLAPSVQKGENVHKHSRLAEVLQLGSDILPQYKQEAPKTP
PHIILHYCVFKTTWDWIILILTFYTAILVPYNVSFKTRQNNVAWLVVDSIVDVIFLVDIV
LNFHTTFVGPAGEVISDPKLIRMNYLKTWFVIDLLSCLPYDVINAFENVDEVSAFMGDPG
KIDFADQIPPPLEGRESQGISSLFSSLKVVRLLRLGRVARKLDHYIEYGAAVLVLLVCVF
GLAAHWMACIWYSIGDYEIFDEDTKTIRNNSWLYQLAMDIGTPYQFNGSGSGKWEGGPSK
NSVYISSLYFTMTSLTSVGFGNIAPSTDIEKIFAVAIMMIGSLLYATIFGNVTTIFQQMY
ANTNRYHEMLNSVRDFLKLYQVPKGLSERVMDYIVSTWSMSRGIDTEKVLQICPKDMRAD
ICVHLNRKVFKEHPAFRLASDGCLRALAMEFQTVHCAPGDLIYHAGESVDSLCFVVSGSL
EVIQDDEVVAILGKGDVFGDVFWKEATLAQSCANVRALTYCDLHVIKRDALQKVLEFYTA
FSHSFSRNLILTYNLRKRIVFRKISDVKREEEERMKRKNEAPLILPPDHPVRRLFQRFRQ
QKEARLAAARGSRDPEDTDVEKGGALSEPSATSRGLVLASVVTVRESPATPVPLQAAPGP
GSGPGSDLARLHAPGSECAGAKRRGWARFKDACGKAEDWSQVSKAESMETLPERTKAPGE
ATLKKTDSCDSGITKSDLRLDNAGEARSPQDRSPVLAEAKHSFYPIPEQTLQAAVLEAKL
ELKEDIKALNAKVASVEKQLSEILRILTARRSSQSPQELFEISGPQSPDSERDIFGRS
Download sequence
Identical sequences G5BAN1
HGL_H00000271751

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]