SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G5BB26 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5BB26
Domain Number 1 Region: 296-546
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.22e-49
Family Voltage-gated potassium channels 0.0014
Further Details:      
 
Domain Number 2 Region: 181-242
Classification Level Classification E-value
Superfamily POZ domain 0.00000000000000262
Family Tetramerization domain of potassium channels 0.0014
Further Details:      
 
Weak hits

Sequence:  G5BB26
Domain Number - Region: 35-63
Classification Level Classification E-value
Superfamily Elafin-like 0.00017
Family Elafin-like 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G5BB26
Sequence length 611
Comment (tr|G5BB26|G5BB26_HETGA) Potassium voltage-gated channel subfamily S member 1 {ECO:0000313|EMBL:EHB06491.1} KW=Complete proteome; Reference proteome OX=10181 OS=Heterocephalus glaber (Naked mole rat). GN=GW7_20386 OC=Hystricomorpha; Bathyergidae; Heterocephalus.
Sequence
MRIQSILLLVALLALGSQVPAASGRRKGDDKPCLSVPDQCTGDSQCPSGKKCCSQACFRQ
CVPRVLVKRGSCPEDRLRARRSTCVTMTMTAHEGSGVAQVPVAGTAETLPEALEHRAPGK
SPGKSPGKSPGRAGRCSHGERVFGAQRPGPLAAEGRGAARERRRRAAAAERARAGALPNA
AAREFYFDRHPGFFLGLLHFYRTGRLHLLDELCVFAFGQEADYWGLGENALATCCRARYL
ERRMARPRAWDEDSDPPSSGDPCPDEISDVQRELARYGAARCGRLRRRLWLTMENPGYSL
PSKLFSCVSIGVVLASIAAMCIHSLPEYQAREAAAAVAAVGAGRNADDARDDPVLRRLEY
FCIAWFSFEVSSRLLLAPSTRNFFCHPLNLIDIVSVLPFYLTLLAGIALGDRDGGSGEEL
GDLGKVVQVFRLMRIFRVLKLARHSTGLRSLGATLKHSYREVGILLLYLAVGVSVFSGVA
YTAEEKNVGFNTIPACWWWGTVSMTTVGYGDVVPETVAGKLAASGCILGGILVVALPITI
IFNKFSHFYRCQKALEAAVRNSGHREFEDLLSSVDGVSEASLETSRDTSQEGRSVDLETQ
AQGEPPNTQSY
Download sequence
Identical sequences G5BB26
HGL_H00000307694

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]