SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G5BB70 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5BB70
Domain Number 1 Region: 221-529
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 7.03e-101
Family Glutaminase 0.0000156
Further Details:      
 
Domain Number 2 Region: 555-641
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.18e-18
Family Ankyrin repeat 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G5BB70
Sequence length 667
Comment (tr|G5BB70|G5BB70_HETGA) Glutaminase liver isoform, mitochondrial {ECO:0000313|EMBL:EHB06531.1} KW=Complete proteome; Reference proteome OX=10181 OS=Heterocephalus glaber (Naked mole rat). GN=GW7_15749 OC=Hystricomorpha; Bathyergidae; Heterocephalus.
Sequence
MGAPGLGGEGGNRPLLLLQPHPRPSSPSPAQRSLTRLPRTCLARYSSDPLSLPAGAPTSW
ALWGLRSMRALQRALSLAISHCPWAGWGPLSRSPILGGGVWQHLSEAAAQGRETPHSHQP
QRQDHDASQSGMLSRLGDLLFYTIAEGQERIPIHKFTTALKATGLQTSDPRLRDCMSQMY
HMAQESSSGGLLDRDLFQKCVSSNIVLLTQAFRKKFVIPDFEEFTGHVDRIFEDAKELTG
GKVAAYIPQLAKSNPDLWGVSLCTVDGQRHSVGHTKIPFCLQSCVKPLTYAISISTLGTD
YVHKFVGKEPSGLRYNTLSLNEEGIPHNPMVNAGAIVVSSLIKMDCNKAEKFDFVLQYLN
KMAGNEYVGFSNATFQSEKETGDRNYAIGYYLKEKKCFPKGVDMMAALDLYFQLCSVEVT
CESGSVMAATLANGGICPITGESVLSAEAVRNTLSLMHLGDSQLILSFKFVFQVGLPAKS
AVSGAILLVVPNVMGMMCLSPPLDKLGNSQRGINFCQKLVSLFNFHNYDNLRHCARKLDP
RREGGEVRNKTVVNLLFAAYSGDVSALRRFALSAMNMEQKDYDSRTALHVAAAEGHVEVV
KFLIEACKVNPFVKDRWGNIPLDDAVQFNHLEVVKLLQDYQDSYTISESQAEAAAEALSK
ENLESMV
Download sequence
Identical sequences G5BB70
HGL_H00000310447

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]