SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G5BBU9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5BBU9
Domain Number 1 Region: 13-70,98-158
Classification Level Classification E-value
Superfamily POZ domain 1.29e-27
Family BTB/POZ domain 0.001
Further Details:      
 
Domain Number 2 Region: 354-405
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000106
Family Classic zinc finger, C2H2 0.00082
Further Details:      
 
Domain Number 3 Region: 392-451
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000238
Family Classic zinc finger, C2H2 0.00068
Further Details:      
 
Domain Number 4 Region: 465-519
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000393
Family Classic zinc finger, C2H2 0.032
Further Details:      
 
Domain Number 5 Region: 594-629
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000662
Family Classic zinc finger, C2H2 0.025
Further Details:      
 
Weak hits

Sequence:  G5BBU9
Domain Number - Region: 291-315
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00196
Family Classic zinc finger, C2H2 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G5BBU9
Sequence length 687
Comment (tr|G5BBU9|G5BBU9_HETGA) POZ-, AT hook-, and zinc finger-containing protein 1 {ECO:0000313|EMBL:EHB06760.1} KW=Complete proteome; Reference proteome OX=10181 OS=Heterocephalus glaber (Naked mole rat). GN=GW7_17666 OC=Hystricomorpha; Bathyergidae; Heterocephalus.
Sequence
MERVNDASCGPSGCYTYQVSRHSTEMLHNLNQQRKNGGRFCDVLLRVGDESFPAHRAVLA
ACSEYFESVFSAQLGDGGAADGGPSDVGGASAAPGGGAGGSRELEMHTISSKVFGDILDF
AYTSRIVVRLESFPELMTAAKFLLMRSVIEICQEVIKQSNVQILVPPARADIMLFRPPGT
SDLGFPLDMTNGAALAANSNGIAGSMQPEEEAARAAGAAISSQASLPVLPGVDRLPMVAG
PLSPQLLTSPFPNVASSTPPLTGKRGRGRPRKANLLDSMLGSPGGLREAGILPCGLCGKV
FTDANRLRQHEAQHGVTSLQLGYIDLPPPRLGENGLPISEDPDGPRKRSRTRKQVACEIC
GKIFRDVYHLNRHKLSHSGEKPYSCPVCGLRFKRKDRMSYHVRSHDGSVGKPYICQSCGK
GFSRPDHLNGHIKQVHTSERPHKCQTCNASFATRDRLRSHLACHEDKVPCQVCGKYLRAA
YMADHLKKHSEGPSNFCSICNRGFSSASYLKVHVKTHHGVPLPQVSRHQEPIPNGGAAFH
CARTYGNKEGQKCSHQDPIESSDSYGDLSDASDLKTPEKQSTNGSFSCDMAVPKNKMESD
GEKKYPCPECGSFFRSKSYLNKHIQKVHVRSLGGSLGDLGPALGSPFSPQQNMSLLESFG
FQIVQSAFASSLVDPEVDQQPMGPEGK
Download sequence
Identical sequences G5BBU9
HGL_H00000266269 XP_004843539.1.39548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]