SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G5BC66 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5BC66
Domain Number 1 Region: 26-246
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.82e-24
Family Voltage-gated potassium channels 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G5BC66
Sequence length 401
Comment (tr|G5BC66|G5BC66_HETGA) Cation channel sperm-associated protein 4 {ECO:0000313|EMBL:EHB06877.1} KW=Complete proteome; Reference proteome OX=10181 OS=Heterocephalus glaber (Naked mole rat). GN=GW7_11561 OC=Hystricomorpha; Bathyergidae; Heterocephalus.
Sequence
MVSTLSQDAWDKQEFIRMSIQYMLQHPAFHLLLASLLVTNAITIALRTNSFLDQKHYELF
SVIDNIVLTTLICEVLLRWLSDFWIFWKDGWNILNFFIVCMLVLGVLDVVNVSITYCLRV
LRLVHVCMAVEPLARIIRVILQAGPGMAQIGVLILFVMLVFALLGVTLFGEFVPIHFGNL
GVALYTLFVCLTQDGWVDIYSDFRIKERDYALEIGGAIYFAVFIIIGGIIGMNLLVTVVI
RNLEQIMKTKEQEQQHQKNFSETGAEKEDRSHELPLLHCALARMEKSGLHQEPLVGSPMS
NVSENMLDNFCLVLEAIEDNLIQYRKIREELDNIVQEVHSIPFNKEQVEELMHRPFSMSL
MESGSSVDFQNIAKQQDLFTALVSRAKCGLSQLSSSPEADN
Download sequence
Identical sequences G5BC66
HGL_H00000341006

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]