SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G5BD75 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5BD75
Domain Number 1 Region: 197-450
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 9.94e-56
Family Voltage-gated potassium channels 0.00083
Further Details:      
 
Domain Number 2 Region: 36-126
Classification Level Classification E-value
Superfamily POZ domain 9.16e-30
Family Tetramerization domain of potassium channels 0.000024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G5BD75
Sequence length 624
Comment (tr|G5BD75|G5BD75_HETGA) Potassium voltage-gated channel subfamily C member 4 {ECO:0000313|EMBL:EHB07236.1} KW=Complete proteome; Reference proteome OX=10181 OS=Heterocephalus glaber (Naked mole rat). GN=GW7_07810 OC=Hystricomorpha; Bathyergidae; Heterocephalus.
Sequence
MISSVCVSSYRGRKSGNKPPSKTCLKEEMAKGEASEKIIINVGGTRHETYRSTLRTLPGT
RLAWPADPFFFDRHPGVFAYVLNYYRTGKLHCPADVCGPLFEEELTFWGIDETDVEPCCW
MTYRQHRDAEEALDIFESPDGGSGGAGPSDEAGDDERELALQRLGPHEGGAGPGSGSGGC
RGWQPRMWALFEDPYSSRAARVVAFASLFFILVSITTFCLETHEAFNIDRNVTEIHRVGN
ITSVHFRREVETEPILTYIEGVCVLWFTLEFLVRIVCCPDTLDFVKNLLNIIDFVAILPF
YLEVGLSGLSSKAARDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLI
IFLALGVLIFATMIYYAERIGARPSDPRGNDHTDFKNIPIGFWWAVVTMTTLGYGDMYPK
TWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMAKQKLPKKRKKHVPRPAQLESP
LYCKSEETSPRDSTYSDTSPPAREEGMVERKRADSKQNGEANVVLSDEEGAGLTQPLASA
PTPEERRALRRSGTRDRNKKAAACFLLSAGDYVCADGSVRKVSTTALTQSPGHLDCQALT
VDMCLRWQKQQQQSATWKEMAWRP
Download sequence
Identical sequences G5BD75
HGL_H00000358802

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]