SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G5BDI0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5BDI0
Domain Number 1 Region: 550-830
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.9e-56
Family Protein kinases, catalytic subunit 0.00021
Further Details:      
 
Domain Number 2 Region: 6-210
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 1.73e-17
Family Quinoprotein alcohol dehydrogenase-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G5BDI0
Sequence length 956
Comment (tr|G5BDI0|G5BDI0_HETGA) Serine/threonine-protein kinase/endoribonuclease IRE1 {ECO:0000313|EMBL:EHB07341.1} KW=Complete proteome; Reference proteome OX=10181 OS=Heterocephalus glaber (Naked mole rat). GN=GW7_17443 OC=Hystricomorpha; Bathyergidae; Heterocephalus.
Sequence
LQIFASTSTVTLPETLLFVSTLDGSLHAVSKRTGSIKWTLKEDPVLQVPTHVEEPAFLPD
PNDGSLYTLGGKNNEGLTKLPFTIPELVQASPCRSSDGILYMGKKQDIWYVIDLLTGEKQ
QTLSSAFADSLCPSTSLLYLGRTEYTITMYDTKTRELRWNATYFDYAASLPEDDGDYKMS
HFVSNGDGLVVTVDSESGDVLWIQNYASPVVAFYVWQREGLRKVMHINVAVETLRYLTFM
PGEVGRITKWKYPFPKETEAKSKLTPTLYVGKYSTSLYASPSMVHEGVVVVPRGSTLPLL
EGPQTDGVTIGDKGECVITPSTDLKFDPGLKGKSKLNYLRNYWLLIGHHETPLSASTKML
ERFPNNLPKHRENVIPAKKSFEEVINLVDQTSENAPTTMFQDVEEKLAHAPAKPEAPVDS
MLKDMATIILSTFLLVGWVAFIISYPLSIHQQRQLQHQQFKKELEKIQLLQQQQLPFHPP
GELTQDTELLDTSSPYSESSGTSSPSPSPRASNHSLHSSSSASKAGTSASLEQDDKDEET
SMVIVGKISFCPRDVLGHGAEGTIVYRGMFDSRDVAVKRILPECFSFADREVQLLRESDE
HPNVIRYFCTERDRQFQYIAIELCAATLQEYVEQKDFAHLGLEPITLLQQTTSGLAHLHS
LNIVHRDLKPHNILLSMPNAHGRIKAMISDFGLCKKLAVGRHSFSRRSGVPGTEGWIAPE
MLSEDCKENPTYTVDIFSAGCVFYYVISEGSHPFGKSLQRQANILLGAYSLDCFHPEKHE
DIIARELIEKMITMDPQQRPSAKHVLKHPFFWSVEKQLQFFQDVSDRIEKESLDGPIVRQ
LERGGRAVVKMDWRENITVPLQTDLRKFRTYKGGSVRDLLRAMRNKKHHYRELPVEVQET
LGSLPDDFVRYFTSRFPHLLSHTYWAMELCSHERLFQPYYFHEPPEPPPPVTPDVL
Download sequence
Identical sequences G5BDI0
HGL_H00000401445

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]