SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G5BED9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5BED9
Domain Number 1 Region: 226-297
Classification Level Classification E-value
Superfamily SH3-domain 6.3e-18
Family SH3-domain 0.00065
Further Details:      
 
Domain Number 2 Region: 76-134
Classification Level Classification E-value
Superfamily Cysteine-rich domain 9.72e-16
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.006
Further Details:      
 
Domain Number 3 Region: 303-358
Classification Level Classification E-value
Superfamily SH3-domain 0.0000367
Family SH3-domain 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G5BED9
Sequence length 358
Comment (tr|G5BED9|G5BED9_HETGA) SH3 and cysteine-rich domain-containing protein 3 {ECO:0000313|EMBL:EHB07650.1} KW=Complete proteome; Reference proteome OX=10181 OS=Heterocephalus glaber (Naked mole rat). GN=GW7_04692 OC=Hystricomorpha; Bathyergidae; Heterocephalus.
Sequence
EVLESPKPSLPAETPQSGLQRLKQLFRKESPETKEMELPPEPQANGEAVGAGGGPIYYIY
EEEEEEEEEEPPPEPPKLVNDKPHKFKDHFFKKPKFCDVCARMIVLNNKFGLRCKNCKTN
IHEHCQSYVEMQRCFGKIPPGFRRAYSSPLYSNQQYACVKDPSAANRNDPVFETLRTGVI
MANKERKKGQADKKNLLTAMMEEEPESAKPEEGKAQDGNPEGNKKAEKKTPDDKHKQPGF
QQSHYFVALYRFKALEKDDLDFPPGEKIIVIDDSNEEWWRGKIGEKVGFFPPNFIIRVRA
GERVHRVTRSFVGNREIGQITLKKDQIVVQKGDEAGGYVKVYTGRKVGLFPTDFLEEI
Download sequence
Identical sequences G5BED9
HGL_H00000329200

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]