SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G5BHN5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5BHN5
Domain Number 1 Region: 19-237
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 3.15e-77
Family Phosphate binding protein-like 0.00000323
Further Details:      
 
Domain Number 2 Region: 239-297,331-353
Classification Level Classification E-value
Superfamily Porphobilinogen deaminase (hydroxymethylbilane synthase), C-terminal domain 1.44e-19
Family Porphobilinogen deaminase (hydroxymethylbilane synthase), C-terminal domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G5BHN5
Sequence length 361
Comment (tr|G5BHN5|G5BHN5_HETGA) Porphobilinogen deaminase isoform 4 {ECO:0000313|EMBL:JAO00407.1} KW=Complete proteome; Reference proteome OX=10181 OS=Heterocephalus glaber (Naked mole rat). GN=GW7_18679 OC=Hystricomorpha; Bathyergidae; Heterocephalus.
Sequence
MSGNGVSAATAEEDGSKMRVIRVGTRKSQLARIQTDTVVAMLKALYPGLQFEIVAMSTTG
DKILDTALSKIGEKSLFTKELEYALERNEVDLVVHSLKDLPTVLPPGFTIGAICKRESPY
DAVVFHPKFVGKTLQTLPEKSVVGTSSLRRAAQLQRKFPHLEFKSIRGNLNTRLRKLDEQ
QEFSAIILAVAGLQRLGWQNRVGQILHPEECMYAVGQGALGVEVRAKDQDVLNLVDVLHD
PETLLRCIAERAFLRHLEGGCSVPVAVHTVMKDGQLYLTGGVWSLDGSDSMQETMQATIH
VPVQHEDGPEDDPQLVGITAQNIPRGAQLAAENLGISLANLLLSKGAKNILDVARQLNDV
H
Download sequence
Identical sequences G5BHN5
HGL_H00000278715 XP_004856816.1.39548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]