SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G5BJ43 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5BJ43
Domain Number 1 Region: 88-180
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 7.74e-21
Family Canonical RBD 0.00000471
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G5BJ43
Sequence length 549
Comment (tr|G5BJ43|G5BJ43_HETGA) Eukaryotic translation initiation factor 4B {ECO:0000313|EMBL:EHB09304.1} KW=Complete proteome; Reference proteome OX=10181 OS=Heterocephalus glaber (Naked mole rat). GN=GW7_10820 OC=Hystricomorpha; Bathyergidae; Heterocephalus.
Sequence
MAASAKKKNKKGKTISLTDFLAEDGGTGGGTTYVPKPVSWADETDDLEGDVSTTWHSNDD
DVYRAPPIDRSILPTAPRAAREPNIDRSRLPKSPPYTAFLGNLPYDVTEDSIKEFFRGLN
ISAVRLPREPSNPERLKGFGYAEFEDLDSLLSALSLNEESLGNRRIRVDVADQAQDKDRD
DRSFGRDRNRDSDKTDTDWRARPATDSFDDYPPRRGDDSFGDKYRDRYDSDRYRDGYRDG
PRRDMDRYGGRDRYDDRGSRDYDRGYDSRIGSGRRAFGSGYRRDDDYRGGGDRYEDRYDR
RDDRPWGSRDDYSRDDYRRDDRGPPQRPKLNLKPRSTPKEDDSSASTSQSSRAASIFGGA
KPVDTAAREREVEERLQKEQEKLQRQLDEPKLERRPRERHPSWRSEETQERERSRTGSES
SQTGTSAPSGRNARRRESEKSLENETLNKEEDCHSPTSKPPKPDQPLKVMPAPPPKENAW
VKRSSNPPARSQSSDTEQQSPTRKDGKKDQDSRSAPEPKKPEENPSSKFSSASKYAALSV
DGEDENEGD
Download sequence
Identical sequences G5BJ43
HGL_H00000396578-3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]