SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G5BJH9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5BJH9
Domain Number 1 Region: 2-112
Classification Level Classification E-value
Superfamily Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase 2.54e-20
Family Antibiotic resistance proteins 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G5BJH9
Sequence length 117
Comment (tr|G5BJH9|G5BJH9_HETGA) Glyoxalase domain-containing protein 5 {ECO:0000313|EMBL:EHB09440.1} KW=Complete proteome; Reference proteome OX=10181 OS=Heterocephalus glaber (Naked mole rat). GN=GW7_20076 OC=Hystricomorpha; Bathyergidae; Heterocephalus.
Sequence
MTVKSIKDTTTFYSKVLGMEVTTFKGDQKALRFGDQKFNLHEMGKEFEPKAIHPLPGSLD
ICLITEAPLEEMIQRLKAFDVPIEEGPVPRTGAKGPIMSIYFRDPDRNLIEVSNYIS
Download sequence
Identical sequences G5BJH9
HGL_H00000411492

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]