SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G5BJY3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5BJY3
Domain Number 1 Region: 1-471
Classification Level Classification E-value
Superfamily ALDH-like 3.01e-156
Family ALDH-like 0.0000000978
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G5BJY3
Sequence length 473
Comment (tr|G5BJY3|G5BJY3_HETGA) Succinate-semialdehyde dehydrogenase, mitochondrial {ECO:0000313|EMBL:EHB09594.1} KW=Complete proteome; Reference proteome OX=10181 OS=Heterocephalus glaber (Naked mole rat). GN=GW7_06350 OC=Hystricomorpha; Bathyergidae; Heterocephalus.
Sequence
DPASGAAMASVADCGASEARAAVRVAHEAFCSWRGVSAKERSSLLRKWYDLMMQNKDDLA
KIITAESGKPLKEAQGEILYSANFLEWFSEEARRIYGDIISTPAKERRALVLKQPLGVAA
VITPWNFPSAMITRKVGAALAAGCTVVVKPAEDTPFSALALAQFSASLCLMTFAGCFPLQ
LSNQAGIPSGVYNVIPCSRTKAKEVGEVLCTDPLVSKISFTGSTATGKVLLHHAASTVKR
VSMELGGLAPFIVFDSANVDQAVAGAMASKFRNAGQTCVCANRFLVQKGIHDSFVKKFAE
AIQKSLRIGSGFEEGTTQGPLINEKAVEKVEKQVSDAVSKGATVVTGGKRHPYGRNFFEP
TLLSNVTRDMLCSREETFGPLAPVIKFDTEEEAIAVANAAEVGLAGYFYSRDPAQIWRVA
EQLEVGMVGVNEGLISSVECPFGGVKQSGLGREGSKYGIDEYLEVKYVCYGGL
Download sequence
Identical sequences G5BJY3
HGL_H00000314649

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]