SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G5BKK9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5BKK9
Domain Number 1 Region: 486-718
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.96e-37
Family Voltage-gated potassium channels 0.016
Further Details:      
 
Domain Number 2 Region: 1164-1322,1359-1436
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.32e-32
Family Voltage-gated potassium channels 0.027
Further Details:      
 
Domain Number 3 Region: 101-257,299-369
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.73e-30
Family Voltage-gated potassium channels 0.02
Further Details:      
 
Domain Number 4 Region: 1485-1731
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 5.89e-28
Family Voltage-gated potassium channels 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G5BKK9
Sequence length 2317
Comment (tr|G5BKK9|G5BKK9_HETGA) Voltage-dependent R-type calcium channel subunit alpha {ECO:0000256|RuleBase:RU003808} KW=Complete proteome; Reference proteome OX=10181 OS=Heterocephalus glaber (Naked mole rat). GN=GW7_08683 OC=Hystricomorpha; Bathyergidae; Heterocephalus.
Sequence
MARFGEAVVGRPGSGDGDSDQSRNRQGTPVPASGPAAAYKQSKAQRARTMALYNPIPVRQ
NCFTVNRSLFIFGEDNIVRKYAKKLIDWPVNLFLNFSFPTPFEYMILATIIANCIVLALE
QHLPEDDKTPMSRRLEKTEPYFIGIFCFEAGIKIVALGFIFHKGSYLRNGWNVMDFIVVL
SGILATAGTHFNTHVDLRTLRAVRVLRPLKLVSGIPSLQIVLKSIMKAMVPLLQIGLLLF
FAILMFAIIGLEFYSGKLHRACFMNNSGILEGFDPPHPCGVQGCPAGYECKDWIGPNDGI
TQFDNILFAVLTVFQCITMEGWTTVLYNTNDALGATWNWLYFIPLIIIGSFFVLNLVLGV
LSGEFAKERERVENRRAFMKLRRQQQIERELNGYRAWIDKAEEVMLAEENKNAGTSALEV
LRRATIKRSRTEAMTRDSSDEHCVDISSVGTPLARASIKSTKVDGASYFRHKERLLRISI
RHMVKSQVFYWIVLSLVALNTACVAIVHHNQPQWLTHLLYYAEFLFLGLFLLEMSLKMYG
MGPRLYFHSSFNCFDFGVTVGSIFEVVWAIFRPGTSFGISVLRALRLLRIFKITKYWASL
RNLVVSLMSSMKSIISLLFLLFLFIVVFALLGMQLFGGRFNFNDGTPSANFDTFPAAIMT
VFQILTGEDWNEVMYNGIRSQGGVSSGMWSAIYFIVLTLFGNYTLLNVFLAIAVDNLANA
QELTKDEQEEEEAFNQKHALQKAKEVSPMSAPNMPSIERDRRRRHHMSMWEPRSSHLRER
RRRHHMSVWEQRTSQLRRHMQMSSQEALNKEEAPPMNPLNPLNPLSPLNPLNAHPSLYRR
SRPIEGLALGLGLEKCEEERISRGGSLKGDGGDLTGALDNQRSPLSLGKREPPWLARPCH
GNCDPTQQEAGGGETVVTFEDRARHRQSQRRSRHRRVRTEGKESASASRSRSASQERSLD
EVGAPEGEKDHEFRGSHGGKEPTIHEEEQSQDLRRTNSLMEPRGSGLAGALDEPDTPLVL
PQPELEVGKDTVLAEQEPEGSSEQALLGDVQLDVGRGISQSEPDLSCITASTDKAATEST
SVTVAIPEVGPLVDSTVVHISNKTDGEASPLKEAEIKEEENEVEKKKQKKEKRETGKAMV
PHSSMFIFSTTNPIRRACHYIVNLRYFEMCILLVIAASSIALAAEDPVLTNSERNKVLRY
FDYVFTGVFTFEMVIKMIDQGLILQDGSYFRDLWNILDFVVVVGALVAFALATNKGRDIK
TIKSLRVLRVLRPLKTIKRLPKLKAVFDCVVTSLKNVFNILIVYKLFMFIFAVIAVQLFK
GKFFYCTDSSKDTEKECIGNYVDHEKNKMEVKGREWKRHEFHYDNIIWALLTLFTVSTGE
GWPQVLQHSVDVTEEDRGPSRSNRMEMSIFYVVYFVVFPFFFVNIFVALIIITFQEQGDK
MMEECSLEKNERACIDFAISAKPLTRYMPQNRHTFQYRVWHFVVSPSFEYTIMAMIALNT
VVLMMKYYSAPCTYELALKYLNIAFTMVFSLECVLKVIAFGFLNYFRDTWNIFDFITVIG
SITEIILTDSKLVNTSGFNMSFLKLXRLILLRQGYTIRILLWTFVQSFKALPYVCLLIAM
LFFIYAIIGMQVFGNIKLDEESHINRHNNFRSFFGSLMLLFRSATGEAWQEIMLSCLGEK
GCEPDTTAPSGQNENERCGTDLAYVYFVSFIFFCSFLMLNLFVAVIMDNFEYLTRDSSIL
GPHHLDEFVRVWAEYDRAACGRIHYTEMYEMLTLMSPPLGLGKRCPSKVAYKRLVLMNMP
VAEDMTVHFTSTLMALIRTALDIKIAKGGADRQQLDSELQKETLAIWPHLSQKMLDLLVP
MPKASDLTVGKIYAAMMIMDYYKQSKVKKQRQQLEEQKNAPMFQRMEPSSLPQEIIANAK
ALPYLQQDPVSGLSGRSGYPSMSPLSPQEIFQLACMDPADDGQFQEQQSLEPEVSELKSV
QSSNYGIYLPSDTQEHAGSGRASSMPRLTMDPQVVTDPSSMRRSFSTIRDKRSNSSWLEE
FSMERSSENTYKSRRRSYHSSLRLSAHRLNSDSGHKSDTHRSGGRERGRSKERKHLLSPD
VSRCNSEERGTQADWDSPERHQSRSPSEGRSQTPNRQGTGSLSESSIPSVSDTSTPRRSR
RQLPPVPPKPRPLLSYSSLMRHAGSISPPADGSEGGSPLTSQALESNNACLTESSNSPHP
QQGQHFSPQRYISEPYLALHEDSHASDCGEEETLTFEAAVATSLGRSNTIGSAPPLRHSW
QMPNGHYRRRRRGGPGPGTMCGAVSDLLSDTEEDDKC
Download sequence
Identical sequences G5BKK9
HGL_H00000350183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]