SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G5BLR2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5BLR2
Domain Number 1 Region: 2-42
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000582
Family Canonical RBD 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G5BLR2
Sequence length 50
Comment (tr|G5BLR2|G5BLR2_HETGA) SRA stem-loop-interacting RNA-binding protein, mitochondrial {ECO:0000313|EMBL:EHB10223.1} KW=Complete proteome; Reference proteome OX=10181 OS=Heterocephalus glaber (Naked mole rat). GN=GW7_08794 OC=Hystricomorpha; Bathyergidae; Heterocephalus.
Sequence
MCWIYFSSEEALQYAVQHENYVIDGVKVYVQIQNPKILQGDQTSDEEKDF
Download sequence
Identical sequences G5BLR2
HGL_H00000238688-2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]