SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G5BMT8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5BMT8
Domain Number 1 Region: 354-550
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.44e-48
Family cAMP-binding domain 0.0000868
Further Details:      
 
Domain Number 2 Region: 108-353
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 9.16e-36
Family Voltage-gated potassium channels 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G5BMT8
Sequence length 639
Comment (tr|G5BMT8|G5BMT8_HETGA) Cyclic nucleotide-gated cation channel alpha-3 {ECO:0000313|EMBL:EHB10599.1} KW=Complete proteome; Reference proteome OX=10181 OS=Heterocephalus glaber (Naked mole rat). GN=GW7_18308 OC=Hystricomorpha; Bathyergidae; Heterocephalus.
Sequence
METRGLARPRRSSFTGPGPSRLSQLICSLRSWAARHLHHEDQRPDAFLERFHGTELMEVS
SRESNAQSSVGSQEQPDRGRGSWPLARNNTNACNNKEEEKKKDAMVVDPSSTLYYRWLTV
IALPVFYNWCLLVCRACFDDLQSEHLTLWLTLDYSADVLYGLDMLVRARTGFLEQGLMVK
DVKRLWKHYTKTLQFKLDMLSLVPTDLAYLKLGMSYPELRFNRLLKFSRLFEFFDRTETR
TNYPNVFRIGNLVLYILIIIHWNACIYFAISKFIGFGTDSWVYPNISKPEYGRLSRKYIY
SLYWSTLTLTTIGETPPPVKDEEYLFVVIDFLVGILIFATIVGNVGSMISNMNASRAEFQ
AKIDSIKQYMQFRKVTKDLETRVIRWFDYLWANRKTVDEKEVLKNLPDKLKAEIAINVHL
DTLKKVRIFQDCEAGLLVELVLKLRPTVFSPGDYICKKGDIGREMYIIKEGRLAVVADDG
VTQFVVLGDGSYFGEISILNIKGSKSGNRRTANIRSIGYSDLFCLSKDDLMEALIEYPEA
KKALEEKGRQILMKDNLIDEDLARAGVDPKDIEEKVEHLESSLDTLQTRFARLLTEYSAT
QMKVKQRLSQLESWVNICGSSLASSEAQGVAAEIEDKQQ
Download sequence
Identical sequences G5BMT8
HGL_H00000386761

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]