SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G5BNQ4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5BNQ4
Domain Number 1 Region: 156-352
Classification Level Classification E-value
Superfamily E set domains 5.6e-72
Family Cytoplasmic domain of inward rectifier potassium channel 0.00000247
Further Details:      
 
Domain Number 2 Region: 48-171
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.35e-22
Family Voltage-gated potassium channels 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G5BNQ4
Sequence length 390
Comment (tr|G5BNQ4|G5BNQ4_HETGA) ATP-sensitive inward rectifier potassium channel 11 isoform 2 {ECO:0000313|EMBL:JAN96554.1} KW=Complete proteome; Reference proteome OX=10181 OS=Heterocephalus glaber (Naked mole rat). GN=GW7_16901 OC=Hystricomorpha; Bathyergidae; Heterocephalus.
Sequence
MLSRKGIIPEEYVLTRLAEDPAEPRYHARERKARFVSKKGNCNVAHKNIREQGRFLQDVF
TTLVDLKWPHTLLIFTMSFLCSWLLFAMIWWLIAFAHGDLAPGEGTTVPCVTSIHSFSSA
FLFSIEVQVTIGFGGRMVTEECPLAILILIVQNIVGLMINAIMLGCIFMKTAQAHRRAET
LIFSKHAVIALRHGRLCFMLRVGDLRKSMIISATIHMQVVRKTTSPEGEVVPLHQVDIPM
ENGVGGNSIFLVAPLIIYHVIDANSPLYDLGPSDLHHHQDLEIIVILEGVVETTGITTQA
RTSYLADEILWGHRFVPIVTEEDGRYSVDYSKFGNTIKVPTPLCTAHQLDEDHSLLDALT
LASTRGPLRKRSVPVAKTKPKFSISPDSLS
Download sequence
Identical sequences G5BNQ4
XP_004851559.1.39548 HGL_H00000345708

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]