SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G5BNX2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5BNX2
Domain Number 1 Region: 59-114
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00000000000102
Family Voltage-gated potassium channels 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G5BNX2
Sequence length 344
Comment (tr|G5BNX2|G5BNX2_HETGA) Potassium voltage-gated channel subfamily D member 3 {ECO:0000313|EMBL:EHB10981.1} KW=Complete proteome; Reference proteome OX=10181 OS=Heterocephalus glaber (Naked mole rat). GN=GW7_03058 OC=Hystricomorpha; Bathyergidae; Heterocephalus.
Sequence
MRSFVSAVPFAELHRTLWKTEDGPTTSVHIHTLQGNWALKQEHQHPHSRLHNLSSDLRYG
DMVPKTIAGKIFGSICSLSGVLVIALPVPVIVSNFSRIYHQNQRADKRRAQKKARLARIR
VAKTGSSNAYLHSKRNGLLNEALELTGTPEEEQMGKTTSLIESQHHHLLHCLEKTTGLSY
LVDDPLLSVRTSTIKNHEFIDEQMFEQNCMESSMQNYPSTRSPSLSSHPSLTTTCCSRRS
KKTTHLPNSNLPATRLRSMQELSTIHIQGSEQPSLTTSRSSLNLKADDGLRPNCKTSQIT
TAIISIPTPPALTPEGESRPAPASPGPNTNIPSIASNVVKVSAL
Download sequence
Identical sequences G5BNX2
HGL_H00000319591-2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]