SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G5BP94 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5BP94
Domain Number 1 Region: 313-396
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000000000000299
Family Splicing factor U2AF subunits 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G5BP94
Sequence length 405
Comment (tr|G5BP94|G5BP94_HETGA) Splicing factor 45 {ECO:0000313|EMBL:EHB11105.1} KW=Complete proteome; Reference proteome OX=10181 OS=Heterocephalus glaber (Naked mole rat). GN=GW7_20016 OC=Hystricomorpha; Bathyergidae; Heterocephalus.
Sequence
MSLYDDLGVETSDSKTEGWSKNFKLLQSQLQVKKAALTQAKSQRTKQSTVLAPVIDLKRG
GSADDRQIVDTPPHVAAGLKDPVPSGFSAGEVLIPLADEYDPMFPNDYEKVVKRQREERQ
RQRELERQKEIEEREKRRKDRHEASGFSRRPDPDSDEDEDYERERRKRSMGGAAIAPPTS
LVEKDKELPRDFPYEEDSRPRSQSSKAAIPPPVYEEQDRPRSPTGPSNSFLANMGGTVAH
KIMQKYGFREGQGLGKHEQGLSTALSVEKTSKRGGKIIVGDATEKGESQDASKKSDSNPL
TEILKCPTKVVLLRNMVGAGEVDEDLEIETKEECEKYGKVGKCVIFEIPGAPDDEAVRIF
LEFERVESAIKAVVDLNGRYFGGRVVKACFYNLDKFRVLDLAEQV
Download sequence
Identical sequences A0A091DTU2 G5BP94
XP_004854583.1.39548 XP_005383918.1.28644 XP_010619708.1.5607 HGL_H00000369218

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]