SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G5BQ94 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5BQ94
Domain Number 1 Region: 17-239
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.66e-64
Family Ankyrin repeat 0.00012
Further Details:      
 
Domain Number 2 Region: 421-502
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000301
Family Tropomyosin 0.0039
Further Details:      
 
Weak hits

Sequence:  G5BQ94
Domain Number - Region: 840-946
Classification Level Classification E-value
Superfamily t-snare proteins 0.00581
Family t-snare proteins 0.0051
Further Details:      
 
Domain Number - Region: 611-643,691-734
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.00654
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G5BQ94
Sequence length 975
Comment (tr|G5BQ94|G5BQ94_HETGA) Ankycorbin {ECO:0000313|EMBL:EHB11455.1} KW=Complete proteome; Reference proteome OX=10181 OS=Heterocephalus glaber (Naked mole rat). GN=GW7_18465 OC=Hystricomorpha; Bathyergidae; Heterocephalus.
Sequence
MKSLKAKFRKSDTNEWNKNDDRLLQAVENGDVEKVASLLGKKGASATKQDSEGKTAFHLA
AAKGHVECLRVMFTHGVDVTVQDTTGHSALHLAAKNGHHECIRKLLQSKCPAEGIDSSGK
TALHYAAARGCLQAVQVLYEHKSPVNLKDLDGNIPLLLAVQNGHTEVCCFLLDHGADVNS
RDKNGRTALMLACEIGNLNIVEALIKKGADINLVDSLGHNALHYSKLSENAGIQSLLLSK
ISQDADLKTPTKPKQHEQVSKISSERSGTPKKRKAPPPPISPTQLSDVSSPRSITSTPLS
GKESLFFAEPPFKAEISSIRENKDRLSDSTTGGDSLLDISSEADQQDLLVLLQAKVASLT
LHNKELQDKLQAKSPKDTEGDLSIGSLHSTQSDLAPSLSKPSDADPPDSKSSPSGVTHSA
DSSIRIQQLQESLQDLQKRLESSETERKQLQTELQTRRTELVCLNNTDMSENGSDLSQKL
KETQSKYEEAMKEVLSVQKQMKLGLLSHESVDSYSCLHDLRVTDEKIDVLKRDLQNALEE
SERNKEKVRELEEKLVKREKGAVIKPPVEEYEEMKSSYCSVIENMNKEKVFLFEKYQEAQ
EEIMKLKDTLKIQMTQEASDEAGDMKEAMNRMIDELNKQVSELLQLYKEAQAELEDYRKR
KSLEDVTAEYIHKAEHEKLMQVSNVSRAKAEEALSEMKSQYSKVLNELTQLKQLVDTQKE
NFVSITEHLQVITTLRTTGKEMEETIGRLKEHLASKEVEVAKLEKQLLEEKAAMTNAMVP
RSSYEKLQSSLESEVSVLTLKLKESVKEKEKVHSEVSQVRSEVSQVKREKENIQTLLKSK
EEEVNELLQKFRQAQEEIAEMKRYSESSSKLEEDKDKKINEMSKEVTKLKEALNSLSQLS
YSTSSSKRQNQQLEVLQQQVKQLQNQLAECKKHHQEVISVYRMHLLYAVQGQMDEDVQKV
LKQILTMCKNQSQKK
Download sequence
Identical sequences G5BQ94
HGL_H00000388725-2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]