SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G5BRA8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5BRA8
Domain Number 1 Region: 534-591
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.03e-22
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 2 Region: 590-647
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.21e-22
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 3 Region: 366-423
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.08e-21
Family Classic zinc finger, C2H2 0.0082
Further Details:      
 
Domain Number 4 Region: 478-535
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.52e-21
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 
Domain Number 5 Region: 282-339
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.31e-21
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 
Domain Number 6 Region: 422-479
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.19e-20
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Domain Number 7 Region: 634-693
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.3e-17
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 8 Region: 2-54
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 6.02e-17
Family KRAB domain (Kruppel-associated box) 0.00062
Further Details:      
 
Domain Number 9 Region: 226-283
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000434
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 10 Region: 329-361
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000746
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 11 Region: 135-180
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000865
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Weak hits

Sequence:  G5BRA8
Domain Number - Region: 163-218
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000272
Family Classic zinc finger, C2H2 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G5BRA8
Sequence length 693
Comment (tr|G5BRA8|G5BRA8_HETGA) Zinc finger protein 709 {ECO:0000313|EMBL:EHB11819.1} KW=Complete proteome; Reference proteome OX=10181 OS=Heterocephalus glaber (Naked mole rat). GN=GW7_14243 OC=Hystricomorpha; Bathyergidae; Heterocephalus.
Sequence
EAVTFEDVTVNFTMEEWALLNASQKKLYRDVMGETFMNIAAIGRAWDNQEVEEEYKKYWR
NLRNEQVVKHYQYKAWTQYEEIFLWTPDANVNMKQAGLKPAESLACRKPLIGYLSLNVPI
IAPTGLKPSEYLGFEEELYKCDENGRTCGDLQSHQKYARTNAGEKPHEHKQCGKSCSDLS
ERTYLREKAFVCKQNLKASNTPSDVQIYERNHSGVNQYVCKQYEKAFISSHYIQIPEQRH
AEEKPCVSKEWKKGFTYSNSFHRHVSIHTGEKTYVCKHCGKAFSTHSHCQVHERTHTGEK
PYVCKQCGKAFSTHSCCQIHERTHTGEKPYMCKHCGKAFNTHSHCQIHERTHTGEKPYVC
KQCGKAFSRYGNCQIHERSHTGEKPYVCKQCGKAFSTHSHCQVHERTHTGEKPYVCKQCG
KAFSTHSCCQVHERSHTGEKPYVCKQCGKAFSTHSHCQIHERSHTGEKPYVCKQCGKAFS
THSHCQTHERTHTGEKPYVCKQCGKAFSTQSYCKIHERSHTGEKPYVCKLCGKAFSIHAS
CQVHERTHTGEKPYVCKHCGKAFSTHSHWQRHERTHTGEKPYVCKQCGKAFSIHASCQVH
ERTHTGEKPYVCKHCGKAFSTHSHWQRHERTHTGEKPYVCKQCGKAFSIHASCQIHERTH
TGEKPYVCKQCGKAFNTHGHCQRHERTHTEEKP
Download sequence
Identical sequences G5BRA8
HGL_H00000380840-17

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]