SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G5BRT7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5BRT7
Domain Number 1 Region: 3398-3565
Classification Level Classification E-value
Superfamily SPOC domain-like 7.06e-64
Family SPOC domain 0.0000000235
Further Details:      
 
Domain Number 2 Region: 347-501
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 8.19e-31
Family Canonical RBD 0.0034
Further Details:      
 
Domain Number 3 Region: 7-70,247-325
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.000000013
Family Canonical RBD 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G5BRT7
Sequence length 3566
Comment (tr|G5BRT7|G5BRT7_HETGA) Msx2-interacting protein {ECO:0000313|EMBL:EHB11999.1} KW=Complete proteome; Reference proteome OX=10181 OS=Heterocephalus glaber (Naked mole rat). GN=GW7_15519 OC=Hystricomorpha; Bathyergidae; Heterocephalus.
Sequence
MTRASPRYGRVESVKILPKRGSEGGVAAFVDFVDIKSAQKAHNSVNKMGDRDLRTDYNEP
GTIPSAARGLDDTVSIASRSREVSGFRGGGGGPAYGPPPSLHAREGRYERRLDGASDNRE
RAYEHSAYGHHERGTGAFDRTRHYDQDYYRDPRERTLPHGLYYTSPRSRSPNRFDAHDPR
YEPRAREQFTLPSVVHRDIYRDDITREKLKFEGQGFSSVVPCLPRKCKVLSLIPGYPSPK
LKLERLLLPYYCLAASQHDTSLKDGLFHEFKKFGKVTSVQIHGASEERYGLVFFRQQEDQ
EKALTASKGKLFFGMQIEVTAWIGPETESENEFRPLDERIDEFHPKATRTLFIGNLEKTT
TYHDLRNTFQRFGEIVDIDIKKVNGVPQYAFLQYCDIASVCKAIKKMDGEYLGNNRLKLG
FGKSMPTNCVWLDGLSSNVSDQYLTRHFCRYGPVIKVVFDRLKGMALILYNEIEYAQAAV
KETKGRKIGGNKIKVDFANRDSQLAFYHCMEKSGQDVRDFYEMLLERREERRGSYDYNQD
RPYYESVRTPGTYPEDSRRDYPARGREFYSEWETYQGDYYESRYYDDPREYRDYRSDPYE
QDIREYSYRQRERERERERFESDRDRDHERRPIERSQSPTHLRRAQSPGASPSQADRLAS
DSERRLYSRSSDRSGSCSSLSPPRYEKLDKARLERYAKNEKADKERAFDLERMERERRLI
RKEKVEKDKTDKQKRKGKVHSPSSQSSETDQENEQEQSPEKSRSCNKLSREKADKEGIAK
NRLELMPCVVLTRVKEKEGKVIDHTPLEKLKARLDNDTSKSSALDQKLQVSQAEPAKLDL
SKLESVRMKVPKEKLLASHTEVVDKEVRPKPRKHLKPEQSADGLSAVDLEKLEARKRRFA
DSNLKVERQKPEIKKSSPEMEDTRVLLKKMPDVSSRDVVLLREGESERKPVRKEILKRES
KKIKVDKLNTVPSPKDCQELVSISAGSGLRPSSELQARLGEPGVESAENQEIQSKKPIPS
KPQLKQLQLLDDQGPERDDVRKNYCSLRDETLDRKPGQEKPHAVNTEEKIGIDIDHTQSY
RKQMEQSRRKQQMEMEIAKSEKFGSPKKDVDEYERRSLVHEVGKPPQDVTDDSPPSKKKR
MDHVDFDICTKRERNYRSSRQISEDSERTSCSPSIRHGSFHEDDDPLSSPRLMSVKGSPK
VDEKNLPYSSITVREESLKFNPYDSSRREQMADMAKIKLSVLNSEDELNRWDSQMKQDAS
RFDVSFPNSIIKRDSLRKRSVRDLEPGEVPSDSDEDSEHKSHSPRASALYESSRLSFLLR
DREDKLRERDERLSTSLERNKFYSFALDKTITPDTKALLERAKSLSSSREENWSFLDWDS
RFANFRNNKDKEKVDSAPRPIPSWYMKKKKIRTDSEGKMDDKKDNHKEEEQERQELFASR
FLHSSIFEQDSKRLQHLERKDEESDFITGRLYGRQTSDGVNSTSESIQEPVVLFHSRFME
LTRMQQKEKEKDQKPKEIEKQEDTENHPKTPESASENKESELRTPSSVRPPSVTAMTPGT
VSPAPEKTTSEKTVETPLVTEEKTVEAASVSEEAKPVSELAPVSVEQPEQVDLSPGADTS
KDAAVMPSMAESSSTDQLPYLDAKPPTPGASFSPVESRVDPDPDSTQPPSKPTQKPEESD
DPKVEKPDTTAKVEPNPNPKAEIVPEVQPQASENVDVDPPVAAKDKKPNKSKRSKTPVQA
AAASIVEKPVTRKSERIDREKLKRASSPRGEAQKLLELKMEAEKITRTASKNSMGDPEHP
EPSLPLSRTRRRNVRSVYATMSDHENRSPAKEPVEQPRVTRKRLERELQEVAVVPTTPRR
GRPPKTRRRAEEEEENEVKEPTETLKPAEGWRSPRSQKSAVTGGPQGKRGKNEPKVDAER
AEAPTDVSLQVNMKENTKSKPDKEEAGSEQKVNRNDKKEASTDKNAPDTPPVEVVEKKPA
PEKNSKSKRGRSRNSRSAVDRSAHLKSTDTAAGHGEAAGPVAQAEEPEAGVVAVSPEKSE
SPQKEGSSSSQLKNDPAAPNKEPEEEDMSASRVSPEATQLAQQMELEQAVENIEKLTETS
AHAAYKAAASSATKGPTTEDKDKPPHQASETELAAAIGSIINDISGEPENFPAPPRFPAE
SQTSLPSQTQGVQPQGGEMEPETHEAVSGILETEAAAETSGPQDSTSDTSGIPANAREAR
GNGSETSQLAQETKGSKEVEVPLARKDKGRQKAARSRRKRNTNKKVAGAATETHASKTVE
AESKSPAMNKGVAAHPSEPPQEDKQSEKPRCAPPQACTPEPSKSLSAESVSQEISVEEKT
PTKASVLPDLPPPSQPALLDDEAQARFKVHTIIESDPVTPPSDSGNPPPTVPSITAAKLL
PALGPGAVPQQSPPPKVTEWITRQEEPRAQSTPSPALPPDTKASDVDTSSSTLRKILMDP
KYVSATGITSTSVTTAIAEPVSAAPCLHEAAAAPVESKKPPVEEKPAAPITNASDMQASE
VPVATDKEKVAPVIAPKITSVISRMPVSIDLENSQKITLAKPAPQTLTGLVSALTGLVNV
SLVPVNALKGPVKGSVATLKGLVSTPAGPVNVLKGPVNVLTGPVNVLTTPVNATVGTMNA
ATGTVNAAASAVSATAGAVTAASGGVTATAGAAPMTSAVIAPSAKCKQRSSSNENSRFHP
GSMSVIDDRPADTGSGAGLRVNTSEGVVLLSYSGQKTEGPQRISAKISQIPPASAMDIEF
QQSVSKSQVKPDSVTLSQPAPKGPQAPPGFTNVATHSTLVLTAQTYNASPVISSVKADRP
SLEKPEPIHLSVSTPVTQGGTVKVLTQGINTPPVLVHNQLVLTPSIVTTNKKLADPVTLK
IETKVLQPANLGSTLTPHHPPPLPTKLPAEVNHATSGPSTPTDRMVSHSAATKPDTHSPR
SSGPAPPPFPRACHPSSTTSTALSTNATVMLAAGIPVPQFISSIHPEQSVIMPPHSITQT
VSLGHLSQGEVRMNTPTLPSITYSIRPETLHSPRAPLQPQQIEVRAPQRAGTPQPATAGV
STLGSQHPPEEEVHYHLPVARAAAPVQSEVLVMQSEYRLHPYTVPRDVRIMVHPHVAVSE
QPRATEGVVKVPAVSKAPQQPGKESTKTPEAKASPAPAPPPAPVTPSNQLQGLPLTPPVV
VTHGVQIVHSSGELFQEYRYGDIRTYHAPAQLTPTQFPAASSIGLPSRTKTPAQGTPEGE
PLQPIQPAQSAQPAPPVQSTQPALPVPPCNPSQLSQPGQPPCSKMPQVSQEAKGTQTGGI
EQPRLPTVPASRPPEPHTPQVQRAQVEGGQTSYPSPVSVSMKPDLPAPLPTQAAPKQPLF
VPTTSGPSTPPGLALPHTEVQPASKPDSSPHLTSQRSVDMVQLLKKYPIVWQGLLALKND
TAAVQLHFVSGNNVLAHRSLPLSEGGPPLRIAQRMRLEASQLEGVARRMTVETDYCLLLA
LPCGRDQDDVVSQTESLKAAFITYLQAKQAAGIINVPNPGSNQPAYVLQIFPPCEFSESH
LSRLAPDLLASVSNISPHLMIVIASV
Download sequence
Identical sequences G5BRT7
HGL_H00000364912

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]